|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| NMR Structure (2, 4) |
Sites (0, 0)| (no "Site" information available for 2JRY) |
SS Bonds (4, 4)
NMR Structure
|
||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JRY) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JRY) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2JRY) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:46 aligned with CI1BA_CONRA | Q7Z094 from UniProtKB/Swiss-Prot Length:46 Alignment length:46 10 20 30 40 CI1BA_CONRA 1 GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGCSTSSFFKI 46 SCOP domains ---------------------------------------------- SCOP domains CATH domains ---------------------------------------------- CATH domains Pfam domains Toxin_19-2jryA01 A:1-42 ---- Pfam domains SAPs(SNPs) ---------------------------------------------- SAPs(SNPs) PROSITE ----I_CONOTOXIN PDB: A:5-38 -------- PROSITE Transcript ---------------------------------------------- Transcript 2jry A 1 GpSFCKADEKpCEYHADCCNCCLSGICApSTNWILPGCSTSSFxKI 46 | 10| 20 30 40 | | 11-HYP 29-HYP 44-DPN 2-HYP
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2JRY) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2JRY) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (CI1BA_CONRA | Q7Z094)
|
||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|