Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE AND SODIUM CHANNEL ACTIVITY OF AN EXCITATORY I1-SUPERFAMILY CONOTOXIN
 
Authors :  O. Buczek, D. Wei, J. Babon, X. Yang, B. Fiedler, P. Chen, D. Yoshikami, B. Olivera, G. Bulaj, R. Norton
Date :  29 Jun 07  (Deposition) - 23 Oct 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Iota-Conotoxin (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  O. Buczek, D. Wei, J. J. Babon, X. Yang, B. Fiedler, P. Chen, D. Yoshikami, B. M. Olivera, G. Bulaj, R. S. Norton
Structure And Sodium Channel Activity Of An Excitatory I1-Superfamily Conotoxin.
Biochemistry V. 46 9929 2007
PubMed-ID: 17696362  |  Reference-DOI: 10.1021/BI700797F
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - I-SUPERFAMILY CONOTOXIN R11A
    ChainsA
    Organism ScientificCONUS RADIATUS
    Organism Taxid61198
    SynonymR11.6

 Structural Features

(-) Chains, Units

  
NMR Structure (20x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

NMR Structure (2, 4)
No.NameCountTypeFull Name
1DPN1Mod. Amino AcidD-PHENYLALANINE
2HYP3Mod. Amino Acid4-HYDROXYPROLINE

(-) Sites  (0, 0)

(no "Site" information available for 2JRY)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:5 -A:19
2A:12 -A:22
3A:18 -A:27
4A:21 -A:38

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JRY)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JRY)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1I_CONOTOXINPS60019 I-superfamily conotoxin signature.CI1BA_CONRA5-38  1A:5-38

(-) Exons   (0, 0)

(no "Exon" information available for 2JRY)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:46
 aligned with CI1BA_CONRA | Q7Z094 from UniProtKB/Swiss-Prot  Length:46

    Alignment length:46
                                    10        20        30        40      
           CI1BA_CONRA    1 GPSFCKADEKPCEYHADCCNCCLSGICAPSTNWILPGCSTSSFFKI 46
               SCOP domains ---------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------- CATH domains
               Pfam domains Toxin_19-2jryA01 A:1-42                   ---- Pfam domains
         Sec.struct. author ....................eee..eee.................. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------- SAPs(SNPs)
                    PROSITE ----I_CONOTOXIN  PDB: A:5-38          -------- PROSITE
                 Transcript ---------------------------------------------- Transcript
                  2jry A  1 GpSFCKADEKpCEYHADCCNCCLSGICApSTNWILPGCSTSSFxKI 46
                             |      10|       20        30        40   |  
                             |       11-HYP            29-HYP         44-DPN
                             2-HYP                                        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2JRY)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JRY)

(-) Pfam Domains  (1, 1)

NMR Structure

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (CI1BA_CONRA | Q7Z094)
biological process
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    DPN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    HYP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2jry)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jry)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jry
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CI1BA_CONRA | Q7Z094
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CI1BA_CONRA | Q7Z094
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CI1BA_CONRA | Q7Z0942jtu 2p4l

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JRY)