![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2JRA) |
(no "Site" information available for 2JRA) |
(no "SS Bond" information available for 2JRA) |
(no "Cis Peptide Bond" information available for 2JRA) |
(no "SAP(SNP)/Variant" information available for 2JRA) |
(no "PROSITE Motif" information available for 2JRA) |
(no "Exon" information available for 2JRA) |
NMR StructureChain A from PDB Type:PROTEIN Length:67 aligned with Q6N7Y3_RHOPA | Q6N7Y3 from UniProtKB/TrEMBL Length:67 Alignment length:67 10 20 30 40 50 60 Q6N7Y3_RHOPA 1 MMTASDRLGADPTQAASSPGGARAVSIVGNQIDSRELFTVDREIVIAHGDDRYRLRLTSQNKLILTK 67 SCOP domains ------------------------------------------------------------------- SCOP domains CATH domains -------------------------2jraA01 A:26-67 CATH domains Pfam domains ------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 2jra A 1 MMTASDRLGADPTQAASSPGGARAVSIVGNQIDSRELFTVDREIVIAHGDDRYRLRLTSQNKLILTK 67 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:67 aligned with Q6N7Y3_RHOPA | Q6N7Y3 from UniProtKB/TrEMBL Length:67 Alignment length:67 10 20 30 40 50 60 Q6N7Y3_RHOPA 1 MMTASDRLGADPTQAASSPGGARAVSIVGNQIDSRELFTVDREIVIAHGDDRYRLRLTSQNKLILTK 67 SCOP domains ------------------------------------------------------------------- SCOP domains CATH domains -------------------------2jraB01 B:26-67 CATH domains Pfam domains (1) -----------------------------hemP-2jraB01 B:30-67 Pfam domains (1) Pfam domains (2) -----------------------------hemP-2jraB02 B:30-67 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------- Transcript 2jra B 1 MMTASDRLGADPTQAASSPGGARAVSIVGNQIDSRELFTVDREIVIAHGDDRYRLRLTSQNKLILTK 67 10 20 30 40 50 60
|
(no "SCOP Domain" information available for 2JRA) |
NMR Structure |
NMR Structure
|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2JRA)
|
|
|
|
|
|
|