|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JR6) |
Sites (0, 0)| (no "Site" information available for 2JR6) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2JR6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JR6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JR6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JR6) |
Exons (0, 0)| (no "Exon" information available for 2JR6) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:68 aligned with Y874_NEIMA | A1IQS5 from UniProtKB/Swiss-Prot Length:60 Alignment length:68 60 10 20 30 40 50 60 Y874_NEIMA 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARALSEEELKA-------- - SCOP domains d2jr6a_ A: automated matches SCOP domains CATH domains -------2jr6A01 A:8-68 [code=2.20.25.10, no name defined] CATH domains Pfam domains -Trm112p-2jr6A01 A:2-41 --------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------- Transcript 2jr6 A 1 MEKKFLDILVCPVTKGRLEYHQDKQELWSRQAKLAYPIKDGIPYMLENEARPLSEEELKALEHHHHHH 68 10 20 30 40 50 60
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)| NMR Structure |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2JR6)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|