|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JQ4) |
Sites (0, 0)| (no "Site" information available for 2JQ4) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2JQ4) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JQ4) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JQ4) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2JQ4) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:83 aligned with AACP_AGRFC | A9CHM9 from UniProtKB/Swiss-Prot Length:83 Alignment length:83 10 20 30 40 50 60 70 80 AACP_AGRFC 1 MNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLILDGKEAA 83 SCOP domains d2jq4a1 A:1-83 Hypothetical protein Atu2571 SCOP domains CATH domains 2jq4A00 A:1-83 [code=1.10.1200.10, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE CARRIER PDB: A:1-80 UniProt: 1-80 --- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 2jq4 A 1 MNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFDIEFPDNLLNRKSFASIKAIEDTVKLILDGKEAA 83 10 20 30 40 50 60 70 80
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2JQ4) |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2JQ4)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|