Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE HUMAN FXYD4 (CHIF) PROTEIN IN SDS MICELLES
 
Authors :  C. M. Franzin, P. Teriete, F. M. Marassi
Date :  18 Apr 07  (Deposition) - 04 Mar 08  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Protein, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. M. Franzin, P. Teriete, F. M. Marassi
Structural Similarity Of A Membrane Protein In Micelles And Membranes
J. Am. Chem. Soc. V. 129 8078 2007
PubMed-ID: 17567018  |  Reference-DOI: 10.1021/JA0728371
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FXYD DOMAIN-CONTAINING ION TRANSPORT REGULATOR 4
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: C41 (DE3)
    Expression System Taxid: 562
    Expression System Vector: PBCL
    Expression System Vector Type: VECTOR
    Gene: FXYD4
    Organism Common: NORWAY RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116
    Synonym: CHANNEL- INDUCING FACTOR, CHIF, CORTICOSTEROID- INDUCED PROTEIN

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JP3)

(-) Sites  (0, 0)

(no "Site" information available for 2JP3)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JP3)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JP3)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JP3)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FXYDPS01310 FXYD family signature.FXYD4_RAT28-41  1A:8-21

(-) Exons   (6, 6)

NMR Structure (6, 6)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSRNOT000000196491ENSRNOE00000248984chr4:154237571-15423754626FXYD4_RAT-00--
1.2ENSRNOT000000196492ENSRNOE00000139510chr4:154237042-154236103940FXYD4_RAT1-14140--
1.3ENSRNOT000000196493ENSRNOE00000139686chr4:154235293-15423526133FXYD4_RAT14-25121A:1-55
1.4ENSRNOT000000196494ENSRNOE00000139868chr4:154235138-15423511524FXYD4_RAT25-3391A:5-139
1.5ENSRNOT000000196495ENSRNOE00000139952chr4:154234642-15423456875FXYD4_RAT33-58261A:13-3826
1.6ENSRNOT000000196496ENSRNOE00000342659chr4:154234493-15423445737FXYD4_RAT58-70131A:38-5013
1.7ENSRNOT000000196497ENSRNOE00000140217chr4:154234025-15423398838FXYD4_RAT70-83141A:50-6314
1.8ENSRNOT000000196498ENSRNOE00000140314chr4:154233900-154233712189FXYD4_RAT83-8751A:63-675

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:67
 aligned with FXYD4_RAT | Q63113 from UniProtKB/Swiss-Prot  Length:87

    Alignment length:67
                                    30        40        50        60        70        80       
             FXYD4_RAT   21 NGPVDKGSPFYYDWESLQLGGMIFGGLLCIAGIAMALSGKCKCRRNHTPSSLPEKVTPLITPGSAST 87
               SCOP domains ------------------------------------------------------------------- SCOP domains
               CATH domains 2jp3A00 A:1-67 fxyd4 (chif) protein                                 CATH domains
               Pfam domains --ATP1G1_PLM_MAT8-2jp3A01 A:3-53                     -------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------FXYD          ---------------------------------------------- PROSITE
           Transcript 1 (1) 1.3  -------Exon 1.5  PDB: A:13-38    -----------Exon 1.7      ---- Transcript 1 (1)
           Transcript 1 (2) ----Exon 1.4 ------------------------Exon 1.6     ------------1.8   Transcript 1 (2)
                  2jp3 A  1 NGPVDKGSPFYYDWESLQLGGLIFGGLLCIAGIALALSGKCKCRRNHTPSSLPEKVTPLITPGSAST 67
                                    10        20        30        40        50        60
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2JP3)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: no clan defined [family: ATP1G1_PLM_MAT8] (5)

(-) Gene Ontology  (13, 13)

NMR Structure(hide GO term definitions)
Chain A   (FXYD4_RAT | Q63113)
molecular function
    GO:0051117    ATPase binding    Interacting selectively and non-covalently with an ATPase, any enzyme that catalyzes the hydrolysis of ATP.
    GO:0005216    ion channel activity    Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
    GO:0005267    potassium channel activity    Enables the facilitated diffusion of a potassium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0017080    sodium channel regulator activity    Modulates the activity of a sodium channel.
biological process
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0071805    potassium ion transmembrane transport    A process in which a potassium ion is transported from one side of a membrane to the other.
    GO:2000649    regulation of sodium ion transmembrane transporter activity    Any process that modulates the frequency, rate or extent of sodium ion transmembrane transporter activity.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jp3)
 
  Sites
(no "Sites" information available for 2jp3)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jp3)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jp3
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FXYD4_RAT | Q63113
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FXYD4_RAT | Q63113
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2JP3)

(-) Related Entries Specified in the PDB File

2jol FXYD1