|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JNT) |
Sites (0, 0)| (no "Site" information available for 2JNT) |
SS Bonds (2, 2)
NMR Structure
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JNT) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JNT) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JNT) |
Exons (0, 0)| (no "Exon" information available for 2JNT) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:108 aligned with Q8MMK7_BOMMO | Q8MMK7 from UniProtKB/TrEMBL Length:127 Alignment length:108 29 39 49 59 69 79 89 99 109 119 Q8MMK7_BOMMO 20 YTDKYDKINLQEILENKRLLESYMDCVLGKGKCTPEGKELKDHLQEALETGCEKCTEAQEKGAETSIDYLIKNELEIWKELTAHFDPDGKWRKKYEDRAKAKGIVIPE 127 SCOP domains d2jnta_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains OS-D-2jntA01 A:1-95 ------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 2jnt A 1 YTDKYDKINLQEILENKRLLESYMDCVLGKGKCTPEGKELKDHLQEALETGCEKCTEAQEKGAETSIDYLIKNELEIWKELTAHFDPDGKWRKKYEDRAKAKGIVIPE 108 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2JNT) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2JNT)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|