Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF FLY TROPONIN C, ISOFORM F1
 
Authors :  G. F. De Nicola, B. Bullard, A. Pastore
Date :  18 Jan 07  (Deposition) - 07 Aug 07  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Stretch Activated Muscle Contraction, Troponin C, Ef-Hand, Lethocerus Indicus, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. De Nicola, C. Burkart, F. Qiu, B. Agianian, S. Labeit, S. Martin, B. Bullard, A. Pastore
The Structure Of Lethocerus Troponin C: Insights Into The Mechanism Of Stretch Activation In Muscles
Structure V. 15 813 2007
PubMed-ID: 17637342  |  Reference-DOI: 10.1016/J.STR.2007.05.007
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TROPONIN C
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21 PLYSS
    Expression System Taxid562
    Expression System VectorPETM-11
    Expression System Vector TypeVECTOR
    GeneTNC4
    Organism ScientificLETHOCERUS INDICUS
    Organism Taxid212017

 Structural Features

(-) Chains, Units

  
NMR Structure (10x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2JNF)

(-) Sites  (0, 0)

(no "Site" information available for 2JNF)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2JNF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2JNF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2JNF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2JNF)

(-) Exons   (0, 0)

(no "Exon" information available for 2JNF)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:158
 aligned with Q868D4_9HEMI | Q868D4 from UniProtKB/TrEMBL  Length:158

    Alignment length:158
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150        
         Q868D4_9HEMI     1 MGDVSKLSSNQVKLLETAFRDFETPEGSGRVSTDQIGIILEVLGIQQTKSTIRQLIDEFDPFGNGDIDFDSFKIIGARFLGEEVNPEQMQQELREAFRLYDKEGNGYISTDVMREILAELDETLSSEDLDAMIDEIDADGSGTVDFEEFMGVMTGGDE 158
               SCOP domains d2jnfa_ A: automated matches                                                                                                                                   SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------------------------------------EF_hand_6-2jnfA02 A:38-79                 ------------EF_hand_5-2jnfA01 A:92-153                                    ----- Pfam domains (1)
           Pfam domains (2) -------------------------------------------------------------------------------------------------------------------------------efhand-2jnfA03 A:128-156     -- Pfam domains (2)
         Sec.struct. author .......hhhhhhhhhhhhhhh........eehhhhhhhhhhh....hhhhhhhhhhhhh.....eehhhhhhhhhhhhh...........hhhhhhhhhh......eehhhhhhhhhhhh...hhhhhhhhhhhhh.....ee.hhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2jnf A   1 MGDVSKLSSNQVKLLETAFRDFETPEGSGRVSTDQIGIILEVLGIQQTKSTIRQLIDEFDPFGNGDIDFDSFKIIGARFLGEEVNPEQMQQELREAFRLYDKEGNGYISTDVMREILAELDETLSSEDLDAMIDEIDADGSGTVDFEEFMGVMTGGDE 158
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150        

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2JNF)

(-) Pfam Domains  (3, 3)

NMR Structure
(-)
Clan: EF_hand (270)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (Q868D4_9HEMI | Q868D4)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2jnf)
 
  Sites
(no "Sites" information available for 2jnf)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2jnf)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2jnf
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q868D4_9HEMI | Q868D4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q868D4_9HEMI | Q868D4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q868D4_9HEMI | Q868D42k2a

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2JNF)