|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2JN9) |
Sites (0, 0)| (no "Site" information available for 2JN9) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2JN9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2JN9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2JN9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2JN9) |
Exons (0, 0)| (no "Exon" information available for 2JN9) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:105 aligned with YKVR_BACSU | O31683 from UniProtKB/Swiss-Prot Length:96 Alignment length:105 1 96 | 9 19 29 39 49 59 69 79 89 | - YKVR_BACSU - -MKTLRLNNVTLEMAAYQEESEPKRKIAFTLNVTSETYHDIAVLLYEKTFNVEVPERDLAFRGEMTNYSTSLTNLYEPGAVSEFYIEITEIDKNADS-------- - SCOP domains -d2jn9a1 A:2-97 Uncharacterized protein YkvR -------- SCOP domains CATH domains 2jn9A01 A:1-91 YkvR-like -------------- CATH domains Pfam domains --DUF3219-2jn9A01 A:3-96 --------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 2jn9 A 1 MVKTLRLNNVTLEMAAYQEESEPKRKIAFTLNVTSETYHDIAVLLYEKTFNVEVPERDLAFRGEMTNYSTSLTNLYEPGAVSEFYIEITEIDKNADSLEHHHHHH 105 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (1, 1)| NMR Structure |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2JN9)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|