|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (7, 20) Biological Unit 1 (7, 20) |
Asymmetric Unit (13, 13)
|
(no "SS Bond" information available for 2JE4) |
(no "Cis Peptide Bond" information available for 2JE4) |
(no "SAP(SNP)/Variant" information available for 2JE4) |
Asymmetric Unit (2, 4)
|
(no "Exon" information available for 2JE4) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:99 aligned with O38716_9HIV1 | O38716 from UniProtKB/TrEMBL Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 O38716_9HIV1 1 PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 SCOP domains d2je4a_ A: automated matches SCOP domains CATH domains 2je4A00 A:1-99 Acid Proteases CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2je4 A 1 PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEElNLPGKWKPKlIGGIGGFIKVRQYDQIPVEIaGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 10 20 30 | 40 | 50 60 | 70 80 90 36-NLE 46-NLE 67-DBU Chain A from PDB Type:PROTEIN Length:99 aligned with POL_HV1A2 | P03369 from UniProtKB/Swiss-Prot Length:1437 Alignment length:99 500 510 520 530 540 550 560 570 580 POL_HV1A2 491 PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 589 SCOP domains d2je4a_ A: automated matches SCOP domains CATH domains 2je4A00 A:1-99 Acid Proteases CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -------------------ASP_PROT_RETROV PDB: A:20-89 UniProt: 510-579 ---------- PROSITE (1) PROSITE (2) ---------------------ASP_PROTEASE------------------------------------------------------------------ PROSITE (2) Transcript --------------------------------------------------------------------------------------------------- Transcript 2je4 A 1 PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEElNLPGKWKPKlIGGIGGFIKVRQYDQIPVEIaGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 10 20 30 | 40 | 50 60 | 70 80 90 36-NLE 46-NLE 67-DBU Chain B from PDB Type:PROTEIN Length:99 aligned with O38716_9HIV1 | O38716 from UniProtKB/TrEMBL Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 O38716_9HIV1 1 PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 SCOP domains d2je4b_ B: automated matches SCOP domains CATH domains 2je4B00 B:1-99 Acid Proteases CATH domains Pfam domains (1) ---RVP-2je4B01 B:4-98 - Pfam domains (1) Pfam domains (2) ---RVP-2je4B02 B:4-98 - Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2je4 B 1 PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEElNLPGKWKPKlIGGIGGFIKVRQYDQIPVEIaGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 10 20 30 | 40 | 50 60 | 70 80 90 36-NLE 46-NLE 67-DBU Chain B from PDB Type:PROTEIN Length:99 aligned with POL_HV1A2 | P03369 from UniProtKB/Swiss-Prot Length:1437 Alignment length:99 500 510 520 530 540 550 560 570 580 POL_HV1A2 491 PQITLWQRPLVTIRIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 589 SCOP domains d2je4b_ B: automated matches SCOP domains CATH domains 2je4B00 B:1-99 Acid Proteases CATH domains Pfam domains (1) ---RVP-2je4B01 B:4-98 - Pfam domains (1) Pfam domains (2) ---RVP-2je4B02 B:4-98 - Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) -------------------ASP_PROT_RETROV PDB: B:20-89 UniProt: 510-579 ---------- PROSITE (1) PROSITE (2) ---------------------ASP_PROTEASE------------------------------------------------------------------ PROSITE (2) Transcript --------------------------------------------------------------------------------------------------- Transcript 2je4 B 1 PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEElNLPGKWKPKlIGGIGGFIKVRQYDQIPVEIaGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF 99 10 20 30 | 40 | 50 60 | 70 80 90 36-NLE 46-NLE 67-DBU Chain C from PDB Type:PROTEIN Length:6 SCOP domains ------ SCOP domains CATH domains ------ CATH domains Pfam domains ------ Pfam domains SAPs(SNPs) ------ SAPs(SNPs) PROSITE ------ PROSITE Transcript ------ Transcript 2je4 C 1 SLNxIx 6 | | 4-JG3 6-VME
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit(hide GO term definitions) Chain A,B (O38716_9HIV1 | O38716)
Chain A,B (POL_HV1A2 | P03369)
|
|
|
|
|
|
|