2J16 - JenaLib

Molecule 1 - TYROSINE-PROTEIN PHOSPHATASE YIL113W
	Chains	:	A
	EC Number	:	3.1.3.48
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET14B
	Expression System Strain	:	FB810
	Expression System Taxid	:	562
	Expression System Variant	:	PLYSS
	Fragment	:	RESIDUES 17-198
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932
	Strain	:	S288C / AB972
	Synonym	:	SDP-1

Molecule 2 - TYROSINE-PROTEIN PHOSPHATASE YIL113W
	Chains	:	B
	EC Number	:	3.1.3.48
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET14B
	Expression System Strain	:	FB810
	Expression System Taxid	:	562
	Expression System Variant	:	PLYSS
	Fragment	:	RESIDUES 17-198
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932
	Strain	:	S288C / AB972
	Synonym	:	SDP-1

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 5)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 6)

Asymmetric Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_DUAL	PS50054	Dual specificity protein phosphatase family profile.	SDP1_YEAST	72-195	2	A:72-195 B:72-195
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	SDP1_YEAST	117-173	2	A:117-173 B:117-173
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	SDP1_YEAST	138-148	2	A:138-148 B:138-148

Biological Unit 1 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_DUAL	PS50054	Dual specificity protein phosphatase family profile.	SDP1_YEAST	72-195	1	A:72-195 -
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	SDP1_YEAST	117-173	1	A:117-173 -
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	SDP1_YEAST	138-148	1	A:138-148 -

Biological Unit 2 (3, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_DUAL	PS50054	Dual specificity protein phosphatase family profile.	SDP1_YEAST	72-195	1	- B:72-195
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	SDP1_YEAST	117-173	1	- B:117-173
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	SDP1_YEAST	138-148	1	- B:138-148

Exons (1, 2)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:134
 aligned with SDP1_YEAST | P40479 from UniProtKB/Swiss-Prot  Length:209

    Alignment length:142
                                    65        75        85        95       105       115       125       135       145       155       165       175       185       195  
           SDP1_YEAST    56 YPKGPLLVLPEKIYLYSEPTVKELLPFDVVINVAEEANDLRMQVPAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAK 197
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee...eee.............eeee.....--------..eeee....hhhhhhhhhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh..hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------TYR_PHOSPHATASE_DUAL  PDB: A:72-195 UniProt: 72-195                                                                         -- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: A:117-173 UniProt: 117-173       ------------------------ PROSITE (2)
                PROSITE (3) ----------------------------------------------------------------------------------TYR_PHOSPHA------------------------------------------------- PROSITE (3)
               Transcript 1 Exon 1.1  PDB: A:56-197 (gaps) UniProt: 1-209 [INCOMPLETE]                                                                                     Transcript 1
                 2j16 A  56 YPKGPLLVLPEKIYLYSEPTVKELLPFDVVINVAEEA--------AVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHcQCGLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAK 197
                                    65        75        85      |  -     | 105       115       125       135    |  145       155       165       175       185       195  
                                                               92      101                                    140-CSD

Chain B from PDB  Type:PROTEIN  Length:144
 aligned with SDP1_YEAST | P40479 from UniProtKB/Swiss-Prot  Length:209

    Alignment length:144
                                    63        73        83        93       103       113       123       133       143       153       163       173       183       193    
           SDP1_YEAST    54 RIYPKGPLLVLPEKIYLYSEPTVKELLPFDVVINVAEEANDLRMQVPAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAK 197
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .......eeee...eeee...hhhhhh...eeee.......hhhhh...eeee...........hhhhhhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhh..hhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) ------------------TYR_PHOSPHATASE_DUAL  PDB: B:72-195 UniProt: 72-195                                                                         -- PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: B:117-173 UniProt: 117-173       ------------------------ PROSITE (2)
                PROSITE (3) ------------------------------------------------------------------------------------TYR_PHOSPHA------------------------------------------------- PROSITE (3)
               Transcript 1 Exon 1.1  PDB: B:54-197 UniProt: 1-209 [INCOMPLETE]                                                                                              Transcript 1
                 2j16 B  54 RIYPKGPLLVLPEKIYLYSEPTVKELLPFDVVINVAEEANDLRMQVPAVEYHHYRWEHDSQIALDLPSLTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLLKSRADKINPSIGLIFQLMEWEVALNAK 197
                                    63        73        83        93       103       113       123       133       143       153       163       173       183       193

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (17, 17)

Asymmetric Unit(hide GO term definitions)

Chain A,B (SDP1_YEAST | P40479)

molecular function
	GO:0033550	MAP kinase tyrosine phosphatase activity	Catalysis of the reaction: MAP kinase tyrosine phosphate + H2O = MAP kinase tyrosine + phosphate.
	GO:0017017	MAP kinase tyrosine/serine/threonine phosphatase activity	Catalysis of the reaction: MAP kinase serine/threonine/tyrosine phosphate + H2O = MAP kinase serine/threonine/tyrosine + phosphate.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0008138	protein tyrosine/serine/threonine phosphatase activity	Catalysis of the reactions: protein serine + H2O = protein serine + phosphate; protein threonine phosphate + H2O = protein threonine + phosphate; and protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0000196	MAPK cascade involved in cell wall organization or biogenesis	A MAPK cascade that contributes to cell wall organization or biogenesis.
	GO:0000754	adaptation of signaling pathway by response to pheromone involved in conjugation with cellular fusion	In organisms that undergo conjugation with cellular fusion, the process resulting in desensitization following exposure to pheromone stimulus that act to down-regulate further stimulation or block initial conjugation responses. An example of this is the adaptation to pheromone during conjugation with cellular fusion in Saccharomyces cerevisiae.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0000200	inactivation of MAPK activity involved in cell wall organization or biogenesis	Any process that terminates the activity of the active enzyme MAP kinase in the context of cell wall organization or biogenesis.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	Any peptidyl-tyrosine dephosphorylation that is involved in inactivation of protein kinase activity.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0010969	regulation of pheromone-dependent signal transduction involved in conjugation with cellular fusion	Any process that modulates the frequency, rate or extent of pheromone-dependent signal transduction during conjugation with cellular fusion, a signal transduction process resulting in the relay, amplification or dampening of a signal generated in response to pheromone exposure in organisms that undergo conjugation with cellular fusion.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CSD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MG	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ala A:101 - Val A:102	[ RasMol ]
		Cys A:142 - Gly A:143	[ RasMol ]
		Gln A:141 - Cys A:142	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2j16
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SDP1_YEAST \| P40479
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds