2IU1 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF EIF5 C-TERMINAL DOMAIN

Authors :   C. Bieniossek, P. Schuetz, U. Baumann

Date :   26 May 06 (Deposition) - 01 Jun 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym./Biol. Unit : A

Keywords :   Mfc, Eif5, Gtp-Binding, Phosphorylation, Protein Biosynthesis, Translation Inititation, Initiation Factor, Nucleotide-Binding, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   C. Bieniossek, P. Schutz, M. Bumann, A. Limacher, I. Uson, U. Baumann
The Crystal Structure Of The Carboxy-Terminal Domain Of Human Translation Initiation Factor Eif5.
J. Mol. Biol. V. 360 457 2006
PubMed-ID: 16781736 | Reference-DOI: 10.1016/J.JMB.2006.05.021

Molecule 1 - EUKARYOTIC TRANSLATION INITIATION FACTOR 5
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-22
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Fragment	:	C-TERMINAL DOMAIN RESIDUES 232-431
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	EIF5

		1
Asymmetric/Biological Unit	:	A

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2IU1)

(no "Site" information available for 2IU1)

(no "SS Bond" information available for 2IU1)

(no "Cis Peptide Bond" information available for 2IU1)

(no "SAP(SNP)/Variant" information available for 2IU1)

Asymmetric/Biological Unit (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	W2	PS51363	W2 domain profile.	IF5_HUMAN	233-392	1	A:233-392

Asymmetric/Biological Unit (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.3	ENST00000392715	3	ENSE00001512854	chr14:103801236-103801522	287	IF5_HUMAN	-	0	0	-	-
1.4	ENST00000392715	4	ENSE00000870553	chr14:103801990-103802269	280	IF5_HUMAN	1-24	24	0	-	-
1.5	ENST00000392715	5	ENSE00000870555	chr14:103802373-103802454	82	IF5_HUMAN	25-52	28	0	-	-
1.6	ENST00000392715	6	ENSE00000660588	chr14:103803014-103803186	173	IF5_HUMAN	52-109	58	0	-	-
1.7	ENST00000392715	7	ENSE00000660589	chr14:103803453-103803564	112	IF5_HUMAN	110-147	38	0	-	-
1.8	ENST00000392715	8	ENSE00001291504	chr14:103804664-103804809	146	IF5_HUMAN	147-195	49	0	-	-
1.9	ENST00000392715	9	ENSE00000870559	chr14:103805072-103805230	159	IF5_HUMAN	196-248	53	1	A:232-248	17
1.10	ENST00000392715	10	ENSE00000870560	chr14:103805509-103805670	162	IF5_HUMAN	249-302	54	1	A:249-302	54
1.11	ENST00000392715	11	ENSE00000660593	chr14:103805976-103806140	165	IF5_HUMAN	303-357	55	1	A:303-357	55
1.12	ENST00000392715	12	ENSE00000660594	chr14:103806764-103806898	135	IF5_HUMAN	358-402	45	1	A:358-402	45
1.13	ENST00000392715	13	ENSE00001026216	chr14:103807300-103811359	4060	IF5_HUMAN	403-431	29	1	A:403-410	8

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:179
 aligned with IF5_HUMAN | P55010 from UniProtKB/Swiss-Prot  Length:431

    Alignment length:179
                                   241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401         
            IF5_HUMAN   232 LERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKAAS 410
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh...hhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -W2  PDB: A:233-392 UniProt: 233-392                                                                                                                             ------------------ PROSITE
               Transcript 1 Exon 1.9         Exon 1.10  PDB: A:249-302 UniProt: 249-302            Exon 1.11  PDB: A:303-357 UniProt: 303-357             Exon 1.12  PDB: A:358-402 UniProt: 358-402   1.13     Transcript 1
                 2iu1 A 232 LERTIEERVNILFDFVKKKKEEGVIDSSDKEIVAEAERLDVKAMGPLVLTEVLFNEKIREQIKKYRRHFLRFCHNNKKAQRYLLHGLECVVAMHQAQLISKIPHILKEMYDADLLEEEVIISWSEKASKKYVSKELAKEIRVKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKLES 410
                                   241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2IU1)

(no "CATH Domain" information available for 2IU1)

(no "Pfam Domain" information available for 2IU1)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A (IF5_HUMAN | P55010)

molecular function
	GO:0005525	GTP binding	Interacting selectively and non-covalently with GTP, guanosine triphosphate.
	GO:0003924	GTPase activity	Catalysis of the reaction: GTP + H2O = GDP + phosphate.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008135	translation factor activity, RNA binding	Functions during translation by interacting selectively and non-covalently with RNA during polypeptide synthesis at the ribosome.
	GO:0003743	translation initiation factor activity	Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
	GO:0006446	regulation of translational initiation	Any process that modulates the frequency, rate or extent of translational initiation.
	GO:0006412	translation	The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
	GO:0006413	translational initiation	The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2iu1)

	Sites
(no "Sites" information available for 2iu1)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2iu1)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2iu1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IF5_HUMAN \| P55010
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IF5_HUMAN \| P55010
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IF5_HUMAN \| P55010	:	2e9h 2g2k

(no "Related Entries Specified in the PDB File" available for 2IU1)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (13, 13)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File