Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROTEIN SPO2555 FROM SILICIBACTER POMEROYI, PFAM DUF1028
 
Authors :  J. B. Bonanno, M. Dickey, K. T. Bain, A. Slocombe, S. Ozyurt, S. Wasserma S. K. Burley, S. C. Almo, New York Sgx Research Center For Struct Genomics (Nysgxrc)
Date :  04 Oct 06  (Deposition) - 17 Oct 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.57
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  A,B  (1x)
Keywords :  Structural Genomics, Unknown Function, Psi-2, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. B. Bonanno, M. Dickey, K. T. Bain, A. Slocombe, S. Ozyurt, S. Wasserman, S. K. Burley, S. C. Almo
Crystal Structure Of Hypothetical Protein From Silicibacter Pomeroyi
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN UNP Q5LQD5_SILPO
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: MODIFIED PET26
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: SPO2555
    Organism Scientific: SILICIBACTER POMEROYI
    Organism Taxid: 89184

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B
Biological Unit 3 (1x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 10)

Asymmetric Unit (1, 10)
No.NameCountTypeFull Name
1MSE10Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 5)
No.NameCountTypeFull Name
1MSE5Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 5)
No.NameCountTypeFull Name
1MSE5Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 10)
No.NameCountTypeFull Name
1MSE10Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2IMH)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2IMH)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Asp A:103 -Ile A:104
2Asp B:103 -Ile B:104

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2IMH)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2IMH)

(-) Exons   (0, 0)

(no "Exon" information available for 2IMH)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:226
 aligned with Q5LQD5_RUEPO | Q5LQD5 from UniProtKB/TrEMBL  Length:221

    Alignment length:230
                             1                                                                                                                                                                                                                         221        
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219 |       -
         Q5LQD5_RUEPO     - -MTFSILAHDPETGAIGGAAATGSLCVGGWVLRGDLNAGMSASQGAAPSTFWGEEVLQHLRDGSHPEDAVNHVTSQDSGRAYRQLAAMDLLGNAAAFTGSENQDIKGSVTFASGIASGNMLGDNSVLGAMTEAFVASDLTFERRLLAALIAAEGAGSDFRGLLSAAMLVLHPDRPPVTLRIDYHPDNPIGALEQLYQKATTGDYADWARQVPVLSDKERILD--------   -
               SCOP domains -d2imha1 A:1-229 Hypothetical protein SPO2555                                                                                                                                                                                          SCOP domains
               CATH domains 2imhA01 A:0-216 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                               ------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee......eeeeeee...hhhhhheeee...eeeeee....hhhhhhhhhhhhhh..hhhhhhhhhhhh..hhhh.eeeeee....eeeee........eeeee..eeeeee....hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.----...eeeeeeee..eeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhh..................... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2imh A   0 SLTFSILAHDPETGAIGGAAATGSLCVGGWVLRGDLNAGmSASQGAAPSTFWGEEVLQHLRDGSHPEDAVNHVTSQDSGRAYRQLAAmDLLGNAAAFTGSENQDIKGSVTFASGIASGNmLGDNSVLGAmTEAFVASDLTFERRLLAALIAAEGAG----GLLSAAmLVLHPDRPPVTLRIDYHPDNPIGALEQLYQKATTGDYADWARQVPVLSDKERILDEGHHHHHH 229
                                     9        19        29        39        49        59        69        79       |89        99       109       119       129       139       149     |   -|     |169       179       189       199       209       219       229
                                                                  39-MSE                                          87-MSE                         119-MSE   129-MSE                   155  160     |                                                               
                                                                                                                                                                                                166-MSE                                                           


Chain B from PDB  Type:PROTEIN  Length:217
 aligned with Q5LQD5_RUEPO | Q5LQD5 from UniProtKB/TrEMBL  Length:221

    Alignment length:222
                             1                                                                                                                                                                                                                            
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219  
         Q5LQD5_RUEPO     - -MTFSILAHDPETGAIGGAAATGSLCVGGWVLRGDLNAGMSASQGAAPSTFWGEEVLQHLRDGSHPEDAVNHVTSQDSGRAYRQLAAMDLLGNAAAFTGSENQDIKGSVTFASGIASGNMLGDNSVLGAMTEAFVASDLTFERRLLAALIAAEGAGSDFRGLLSAAMLVLHPDRPPVTLRIDYHPDNPIGALEQLYQKATTGDYADWARQVPVLSDKERILD 221
               SCOP domains d2imhb_ B: Hypothetical protein SPO2555                                                                                                                                                                                        SCOP domains
               CATH domains 2imhB01 B:0-216 Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1                                                                                                                                               ----- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeee......eeeeeee...hhhhhheeee...eeeeee....hhhhhhhhhhhhhh..hhhhhhhhhhhh..hhhh.eeeee.....eeeee........eeeee..eeeeee.....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhh-----...eeeeeeee..eeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhh............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2imh B   0 SLTFSILAHDPETGAIGGAAATGSLCVGGWVLRGDLNAGmSASQGAAPSTFWGEEVLQHLRDGSHPEDAVNHVTSQDSGRAYRQLAAmDLLGNAAAFTGSENQDIKGSVTFASGIASGNmLGDNSVLGAmTEAFVASDLTFERRLLAALIAAEGA-----GLLSAAmLVLHPDRPPVTLRIDYHPDNPIGALEQLYQKATTGDYADWARQVPVLSDKERILD 221
                                     9        19        29        39        49        59        69        79       |89        99       109       119       129       139       149    |    -|     |169       179       189       199       209       219  
                                                                  39-MSE                                          87-MSE                         119-MSE   129-MSE                  154   160     |                                                       
                                                                                                                                                                                                166-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2IMH)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q5LQD5_RUEPO | Q5LQD5)
molecular function
    GO:0003674    molecular_function    Elemental activities, such as catalysis or binding, describing the actions of a gene product at the molecular level. A given gene product may exhibit one or more molecular functions.
biological process
    GO:0008150    biological_process    Any process specifically pertinent to the functioning of integrated living units: cells, tissues, organs, and organisms. A process is a collection of molecular events with a defined beginning and end.
cellular component
    GO:0005575    cellular_component    The part of a cell, extracellular environment or virus in which a gene product is located. A gene product may be located in one or more parts of a cell and its location may be as specific as a particular macromolecular complex, that is, a stable, persistent association of macromolecules that function together.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2imh)
 
  Cis Peptide Bonds
    Asp A:103 - Ile A:104   [ RasMol ]  
    Asp B:103 - Ile B:104   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2imh
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q5LQD5_RUEPO | Q5LQD5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q5LQD5_RUEPO | Q5LQD5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2IMH)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2IMH)