Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  HUMAN NICOTINAMIDE N-METHYLTRANSFERASE
 
Authors :  G. Bernstein, J. Min, H. Wu, W. Tempel, H. Zeng, P. Loppnau, G. V. Avvakumov, G. Wasney, J. Weigelt, M. Sundstrom, C. H. Arrowsmith A. M. Edwards, A. Bochkarev, A. N. Plotnikov, Structural Genomics Consortium (Sgc)
Date :  28 Sep 06  (Deposition) - 10 Oct 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.05
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Mutation, Surface Mutagenesis, Mutant, Methyltransferase, Structural Genomics, Structural Genomics Consortium, Sgc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Bernstein, J. Min, H. Wu, W. Tempel, H. Zeng, P. Loppnau, G. V. Avvakumov, G. Wasney, J. Weigelt, M. Sundstrom, C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, A. N. Plotnikov
The Crystal Structure Of Human Nicotinamide N-Methyltransferase In Complex With Sah
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NICOTINAMIDE N-METHYLTRANSFERASE
    Chains: A, B, C, D
    EC Number: 2.1.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: NNMT
    Mutation: YES
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1SAH4Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 4 (1, 1)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:11 , TYR A:20 , TYR A:25 , GLY A:63 , SER A:64 , GLY A:65 , THR A:67 , TYR A:69 , GLN A:70 , ASP A:85 , TYR A:86 , SER A:87 , ASN A:90 , CYS A:141 , ASP A:142 , VAL A:143 , THR A:163 , LEU A:164 , ALA A:169 , HOH A:4021 , HOH A:4065BINDING SITE FOR RESIDUE SAH A 4001
2AC2SOFTWARETYR B:11 , TYR B:20 , TYR B:25 , GLY B:63 , SER B:64 , GLY B:65 , THR B:67 , TYR B:69 , GLN B:70 , ASP B:85 , TYR B:86 , SER B:87 , ASN B:90 , CYS B:141 , ASP B:142 , VAL B:143 , THR B:163 , LEU B:164 , CYS B:165 , ALA B:169 , HOH B:4003 , HOH B:4009 , HOH B:4023BINDING SITE FOR RESIDUE SAH B 4002
3AC3SOFTWARETYR C:11 , TYR C:20 , TYR C:25 , GLY C:63 , SER C:64 , GLY C:65 , THR C:67 , TYR C:69 , ASP C:85 , TYR C:86 , ASN C:90 , CYS C:141 , ASP C:142 , VAL C:143 , THR C:163 , LEU C:164 , CYS C:165 , ALA C:169 , HOH C:4014BINDING SITE FOR RESIDUE SAH C 4003
4AC4SOFTWARETYR D:11 , TYR D:20 , TYR D:25 , GLY D:63 , SER D:64 , GLY D:65 , THR D:67 , TYR D:69 , ASP D:85 , TYR D:86 , ASN D:90 , CYS D:141 , ASP D:142 , VAL D:143 , THR D:163 , LEU D:164 , CYS D:165 , HOH D:4009BINDING SITE FOR RESIDUE SAH D 4004

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2IIP)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2IIP)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2IIP)

(-) PROSITE Motifs  (2, 8)

Asymmetric Unit (2, 8)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_MT_NNMT_PNMT_TEMTPS51681 SAM-dependent methyltransferase NNMT/PNMT/TEMT-type profile.NNMT_HUMAN8-262
 
 
 
  4A:8-260
B:8-260
C:8-260
D:8-260
2NNMT_PNMT_TEMTPS01100 NNMT/PNMT/TEMT family of methyltransferases signature.NNMT_HUMAN59-75
 
 
 
  4A:59-75
B:59-75
C:59-75
D:59-75
Biological Unit 1 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_MT_NNMT_PNMT_TEMTPS51681 SAM-dependent methyltransferase NNMT/PNMT/TEMT-type profile.NNMT_HUMAN8-262
 
 
 
  1A:8-260
-
-
-
2NNMT_PNMT_TEMTPS01100 NNMT/PNMT/TEMT family of methyltransferases signature.NNMT_HUMAN59-75
 
 
 
  1A:59-75
-
-
-
Biological Unit 2 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_MT_NNMT_PNMT_TEMTPS51681 SAM-dependent methyltransferase NNMT/PNMT/TEMT-type profile.NNMT_HUMAN8-262
 
 
 
  1-
B:8-260
-
-
2NNMT_PNMT_TEMTPS01100 NNMT/PNMT/TEMT family of methyltransferases signature.NNMT_HUMAN59-75
 
 
 
  1-
B:59-75
-
-
Biological Unit 3 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_MT_NNMT_PNMT_TEMTPS51681 SAM-dependent methyltransferase NNMT/PNMT/TEMT-type profile.NNMT_HUMAN8-262
 
 
 
  1-
-
C:8-260
-
2NNMT_PNMT_TEMTPS01100 NNMT/PNMT/TEMT family of methyltransferases signature.NNMT_HUMAN59-75
 
 
 
  1-
-
C:59-75
-
Biological Unit 4 (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SAM_MT_NNMT_PNMT_TEMTPS51681 SAM-dependent methyltransferase NNMT/PNMT/TEMT-type profile.NNMT_HUMAN8-262
 
 
 
  1-
-
-
D:8-260
2NNMT_PNMT_TEMTPS01100 NNMT/PNMT/TEMT family of methyltransferases signature.NNMT_HUMAN59-75
 
 
 
  1-
-
-
D:59-75

(-) Exons   (3, 12)

Asymmetric Unit (3, 12)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENST000002999641ENSE00001130121chr11:114166535-114167432898NNMT_HUMAN1-52524A:1-52 (gaps)
B:1-52 (gaps)
C:5-52 (gaps)
D:4-52 (gaps)
52
52
48
49
1.2ENST000002999642ENSE00001106133chr11:114168673-114168880208NNMT_HUMAN52-121704A:52-121
B:52-121
C:52-121
D:52-121
70
70
70
70
1.3ENST000002999643ENSE00001130113chr11:114182767-114183238472NNMT_HUMAN121-2641444A:121-260
B:121-260
C:121-260
D:121-260
140
140
140
140

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:265
 aligned with NNMT_HUMAN | P40261 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:270
                                      1                                                                                                                                                                                                                                                                   
                                     -|       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260
           NNMT_HUMAN     - ----------MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
               SCOP domains d2iipa_ A: automated matches                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 2iipA00 A:-9-260 Vaccinia Virus prot     ein VP39                                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..................hhhhhh.hhhhhhhhhh.-----hhhhhhhhhhhhhhhhhhhh....eeeeee......hhhhhhhhhheeeeeeee.hhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhheeeeee................eeeeeee.hhhhhh.hhhhhhhhhhhhhh.eeeeeeeeeeee....eeee..eeee....hhhhhhhhhhhh.eeeeeeeee.............eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -----------------SAM_MT_NNMT_PNMT_TEMT  PDB: A:8-260 UniProt: 8-262                                                                                                                                                                                                            PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------NNMT_PNMT_TEMT   ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) ----------Exon 1.1  PDB: A:1-52 (gaps) UniProt: 1-52          --------------------------------------------------------------------Exon 1.3  PDB: A:121-260 UniProt: 121-264 [INCOMPLETE]                                                                                       Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------Exon 1.2  PDB: A:52-121 UniProt: 52-121                               ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2iip A  -9 HSSGLVPRGSMESGFTSKDTYLSHFNPRDYLEKYYK-----SAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
                                     0        10        20     |   - |      40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260
                                                              26    32                                                                                                                                                                                                                                    

Chain B from PDB  Type:PROTEIN  Length:264
 aligned with NNMT_HUMAN | P40261 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:269
                                     1                                                                                                                                                                                                                                                                   
                                     1        11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251         
           NNMT_HUMAN     - ---------MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
               SCOP domains d2iipb_ B: automated matches                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 2iipB00 B:-8-260 Vaccinia Virus pro     tein VP39                                                                                                                                                                                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhh.hhhhhhhhhh.-----hhhhhhhhhhhhhhhhhhhh....eeeeee......hhhhhhhhhheeeeeeee.hhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhheeeeee................eeeeeee.hhhhhh.hhhhhhhhhhhhhh.eeeeeeeeeeee....eeee..eeee....hhhhhhhhhhhh.eeeeeeeee.............eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------SAM_MT_NNMT_PNMT_TEMT  PDB: B:8-260 UniProt: 8-262                                                                                                                                                                                                            PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------NNMT_PNMT_TEMT   ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) ---------Exon 1.1  PDB: B:1-52 (gaps) UniProt: 1-52          --------------------------------------------------------------------Exon 1.3  PDB: B:121-260 UniProt: 121-264 [INCOMPLETE]                                                                                       Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------Exon 1.2  PDB: B:52-121 UniProt: 52-121                               ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2iip B  -8 SSGLVPRGSMESGFTSKDTYLSHFNPRDYLEKYYK-----SAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
                                     1        11        21    |    -|       41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251         
                                                             26    32                                                                                                                                                                                                                                    

Chain C from PDB  Type:PROTEIN  Length:251
 aligned with NNMT_HUMAN | P40261 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:256
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254      
           NNMT_HUMAN     5 FTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
               SCOP domains d2iipc_ C: automated m     atches                                                                                                                                                                                                                                SCOP domains
               CATH domains 2iipC00 C:5-260 Vaccin     ia Virus protein VP39                                                                                                                                                                                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhh.-----hhhhhhhhhhhhhhhhhhhh....eeeeeee.....hhhhhhhhh.eeeeeeee.hhhhhhhhhhhhhh......hhhhhhhhhhhh....hhhhhhhhhhhheeeeee................eeeeeee.hhhhhh.hhhhhhhhhhhhhh.eeeeeeeeeeee....eeee..eeee....hhhhhhhhhhhh.eeeeeeeee.............eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---SAM_MT_NNMT_PNMT_TEMT  PDB: C:8-260 UniProt: 8-262                                                                                                                                                                                                            PROSITE (1)
                PROSITE (2) ------------------------------------------------------NNMT_PNMT_TEMT   ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: C:5-52 (gaps) UniProt: 1-52      --------------------------------------------------------------------Exon 1.3  PDB: C:121-260 UniProt: 121-264 [INCOMPLETE]                                                                                       Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.2  PDB: C:52-121 UniProt: 52-121                               ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2iip C   5 FTSKDTYLSHFNPRDYLEKYYK-----SAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
                                    14        24 |     |34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254      
                                                26    32                                                                                                                                                                                                                                    

Chain D from PDB  Type:PROTEIN  Length:251
 aligned with NNMT_HUMAN | P40261 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:257
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       
           NNMT_HUMAN     4 GFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
               SCOP domains d2iipd_ D: automated m      atches                                                                                                                                                                                                                                SCOP domains
               CATH domains 2iipD00 D:4-260 Vaccin      ia Virus protein VP39                                                                                                                                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh------hhhhhhhhhhhhhhhhhhhh....eeeeee......hhhhhhhhhheeeeeeee.hhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhheeeeee................eeeeeee.hhhhhh.hhhhhhhhhhhhhh.eeeeeeeeeeee....eeee..eeee....hhhhhhhhhhhh.eeeeeeeee.............eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----SAM_MT_NNMT_PNMT_TEMT  PDB: D:8-260 UniProt: 8-262                                                                                                                                                                                                            PROSITE (1)
                PROSITE (2) -------------------------------------------------------NNMT_PNMT_TEMT   ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: D:4-52 (gaps) UniProt: 1-52       --------------------------------------------------------------------Exon 1.3  PDB: D:121-260 UniProt: 121-264 [INCOMPLETE]                                                                                       Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------Exon 1.2  PDB: D:52-121 UniProt: 52-121                               ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2iip D   4 GFTSKDTYLSHFNPRDYLEKYY------SAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
                                    13        23 |      33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       
                                                25     32                                                                                                                                                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2IIP)

(-) Gene Ontology  (10, 18)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (NNMT_HUMAN | P40261)
molecular function
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0008112    nicotinamide N-methyltransferase activity    Catalysis of the reaction: S-adenosyl-L-methionine(1+) + nicotinamide = 1-methylnicotinamide + S-adenosyl-L-homocysteine.
    GO:0030760    pyridine N-methyltransferase activity    Catalysis of the reaction: S-adenosyl-L-methionine(1+) + pyridine = N-methylpyridinium + S-adenosyl-L-homocysteine.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0031100    animal organ regeneration    The regrowth of a lost or destroyed animal organ.
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0010243    response to organonitrogen compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organonitrogen stimulus. An organonitrogen compound is formally a compound containing at least one carbon-nitrogen bond.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SAH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2iip)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2iip
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NNMT_HUMAN | P40261
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  NNMT_HUMAN | P40261
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        NNMT_HUMAN | P40261: 3rod

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2IIP)