2IIP - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Biological Unit 4 (Jmol Viewer)

Title :   HUMAN NICOTINAMIDE N-METHYLTRANSFERASE

Authors :   G. Bernstein, J. Min, H. Wu, W. Tempel, H. Zeng, P. Loppnau, G. V. Avvakumov, G. Wasney, J. Weigelt, M. Sundstrom, C. H. Arrowsmith A. M. Edwards, A. Bochkarev, A. N. Plotnikov, Structural Genomics Consortium (Sgc)

Date :   28 Sep 06 (Deposition) - 10 Oct 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.05

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)
Biol. Unit 3: C  (1x)
Biol. Unit 4: D  (1x)

Keywords :   Mutation, Surface Mutagenesis, Mutant, Methyltransferase, Structural Genomics, Structural Genomics Consortium, Sgc (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Bernstein, J. Min, H. Wu, W. Tempel, H. Zeng, P. Loppnau, G. V. Avvakumov, G. Wasney, J. Weigelt, M. Sundstrom, C. H. Arrowsmith, A. M. Edwards, A. Bochkarev, A. N. Plotnikov
The Crystal Structure Of Human Nicotinamide N-Methyltransferase In Complex With Sah
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - NICOTINAMIDE N-METHYLTRANSFERASE
	Chains	:	A, B, C, D
	EC Number	:	2.1.1.1
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Gene	:	NNMT
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B
Biological Unit 3 (1x)	:			C
Biological Unit 4 (1x)	:				D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	SAH	4	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	SAH	1	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	SAH	1	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Biological Unit 3 (1, 1)

No.	Name	Count	Type	Full Name
1	SAH	1	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Biological Unit 4 (1, 1)

No.	Name	Count	Type	Full Name
1	SAH	1	Ligand/Ion	S-ADENOSYL-L-HOMOCYSTEINE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	TYR A:11 , TYR A:20 , TYR A:25 , GLY A:63 , SER A:64 , GLY A:65 , THR A:67 , TYR A:69 , GLN A:70 , ASP A:85 , TYR A:86 , SER A:87 , ASN A:90 , CYS A:141 , ASP A:142 , VAL A:143 , THR A:163 , LEU A:164 , ALA A:169 , HOH A:4021 , HOH A:4065	BINDING SITE FOR RESIDUE SAH A 4001
2	AC2	SOFTWARE	TYR B:11 , TYR B:20 , TYR B:25 , GLY B:63 , SER B:64 , GLY B:65 , THR B:67 , TYR B:69 , GLN B:70 , ASP B:85 , TYR B:86 , SER B:87 , ASN B:90 , CYS B:141 , ASP B:142 , VAL B:143 , THR B:163 , LEU B:164 , CYS B:165 , ALA B:169 , HOH B:4003 , HOH B:4009 , HOH B:4023	BINDING SITE FOR RESIDUE SAH B 4002
3	AC3	SOFTWARE	TYR C:11 , TYR C:20 , TYR C:25 , GLY C:63 , SER C:64 , GLY C:65 , THR C:67 , TYR C:69 , ASP C:85 , TYR C:86 , ASN C:90 , CYS C:141 , ASP C:142 , VAL C:143 , THR C:163 , LEU C:164 , CYS C:165 , ALA C:169 , HOH C:4014	BINDING SITE FOR RESIDUE SAH C 4003
4	AC4	SOFTWARE	TYR D:11 , TYR D:20 , TYR D:25 , GLY D:63 , SER D:64 , GLY D:65 , THR D:67 , TYR D:69 , ASP D:85 , TYR D:86 , ASN D:90 , CYS D:141 , ASP D:142 , VAL D:143 , THR D:163 , LEU D:164 , CYS D:165 , HOH D:4009	BINDING SITE FOR RESIDUE SAH D 4004

(no "SS Bond" information available for 2IIP)

(no "Cis Peptide Bond" information available for 2IIP)

(no "SAP(SNP)/Variant" information available for 2IIP)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SAM_MT_NNMT_PNMT_TEMT	PS51681	SAM-dependent methyltransferase NNMT/PNMT/TEMT-type profile.	NNMT_HUMAN	8-262	4	A:8-260 B:8-260 C:8-260 D:8-260
2	NNMT_PNMT_TEMT	PS01100	NNMT/PNMT/TEMT family of methyltransferases signature.	NNMT_HUMAN	59-75	4	A:59-75 B:59-75 C:59-75 D:59-75

Biological Unit 1 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SAM_MT_NNMT_PNMT_TEMT	PS51681	SAM-dependent methyltransferase NNMT/PNMT/TEMT-type profile.	NNMT_HUMAN	8-262	1	A:8-260 - - -
2	NNMT_PNMT_TEMT	PS01100	NNMT/PNMT/TEMT family of methyltransferases signature.	NNMT_HUMAN	59-75	1	A:59-75 - - -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SAM_MT_NNMT_PNMT_TEMT	PS51681	SAM-dependent methyltransferase NNMT/PNMT/TEMT-type profile.	NNMT_HUMAN	8-262	1	- B:8-260 - -
2	NNMT_PNMT_TEMT	PS01100	NNMT/PNMT/TEMT family of methyltransferases signature.	NNMT_HUMAN	59-75	1	- B:59-75 - -

Biological Unit 3 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SAM_MT_NNMT_PNMT_TEMT	PS51681	SAM-dependent methyltransferase NNMT/PNMT/TEMT-type profile.	NNMT_HUMAN	8-262	1	- - C:8-260 -
2	NNMT_PNMT_TEMT	PS01100	NNMT/PNMT/TEMT family of methyltransferases signature.	NNMT_HUMAN	59-75	1	- - C:59-75 -

Biological Unit 4 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	SAM_MT_NNMT_PNMT_TEMT	PS51681	SAM-dependent methyltransferase NNMT/PNMT/TEMT-type profile.	NNMT_HUMAN	8-262	1	- - - D:8-260
2	NNMT_PNMT_TEMT	PS01100	NNMT/PNMT/TEMT family of methyltransferases signature.	NNMT_HUMAN	59-75	1	- - - D:59-75

Asymmetric Unit (3, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000299964	1	ENSE00001130121	chr11:114166535-114167432	898	NNMT_HUMAN	1-52	52	4	A:1-52 (gaps) B:1-52 (gaps) C:5-52 (gaps) D:4-52 (gaps)	52 52 48 49
1.2	ENST00000299964	2	ENSE00001106133	chr11:114168673-114168880	208	NNMT_HUMAN	52-121	70	4	A:52-121 B:52-121 C:52-121 D:52-121	70 70 70 70
1.3	ENST00000299964	3	ENSE00001130113	chr11:114182767-114183238	472	NNMT_HUMAN	121-264	144	4	A:121-260 B:121-260 C:121-260 D:121-260	140 140 140 140

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:265
 aligned with NNMT_HUMAN | P40261 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:270
                                      1                                                                                                                                                                                                                                                                   
                                     -|       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260
           NNMT_HUMAN     - ----------MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
               SCOP domains d2iipa_ A: automated matches                                                                                                                                                                                                                                                   SCOP domains
               CATH domains 2iipA00 A:-9-260 Vaccinia Virus prot     ein VP39                                                                                                                                                                                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..................hhhhhh.hhhhhhhhhh.-----hhhhhhhhhhhhhhhhhhhh....eeeeee......hhhhhhhhhheeeeeeee.hhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhheeeeee................eeeeeee.hhhhhh.hhhhhhhhhhhhhh.eeeeeeeeeeee....eeee..eeee....hhhhhhhhhhhh.eeeeeeeee.............eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -----------------SAM_MT_NNMT_PNMT_TEMT  PDB: A:8-260 UniProt: 8-262                                                                                                                                                                                                            PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------NNMT_PNMT_TEMT   ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) ----------Exon 1.1  PDB: A:1-52 (gaps) UniProt: 1-52          --------------------------------------------------------------------Exon 1.3  PDB: A:121-260 UniProt: 121-264 [INCOMPLETE]                                                                                       Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------Exon 1.2  PDB: A:52-121 UniProt: 52-121                               ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2iip A  -9 HSSGLVPRGSMESGFTSKDTYLSHFNPRDYLEKYYK-----SAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
                                     0        10        20     |   - |      40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260
                                                              26    32

Chain B from PDB  Type:PROTEIN  Length:264
 aligned with NNMT_HUMAN | P40261 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:269
                                     1                                                                                                                                                                                                                                                                   
                                     1        11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251         
           NNMT_HUMAN     - ---------MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
               SCOP domains d2iipb_ B: automated matches                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 2iipB00 B:-8-260 Vaccinia Virus pro     tein VP39                                                                                                                                                                                                                             CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...............hhhhhhhh.hhhhhhhhhh.-----hhhhhhhhhhhhhhhhhhhh....eeeeee......hhhhhhhhhheeeeeeee.hhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhheeeeee................eeeeeee.hhhhhh.hhhhhhhhhhhhhh.eeeeeeeeeeee....eeee..eeee....hhhhhhhhhhhh.eeeeeeeee.............eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----------------SAM_MT_NNMT_PNMT_TEMT  PDB: B:8-260 UniProt: 8-262                                                                                                                                                                                                            PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------NNMT_PNMT_TEMT   ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) ---------Exon 1.1  PDB: B:1-52 (gaps) UniProt: 1-52          --------------------------------------------------------------------Exon 1.3  PDB: B:121-260 UniProt: 121-264 [INCOMPLETE]                                                                                       Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------Exon 1.2  PDB: B:52-121 UniProt: 52-121                               ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2iip B  -8 SSGLVPRGSMESGFTSKDTYLSHFNPRDYLEKYYK-----SAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
                                     1        11        21    |    -|       41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251         
                                                             26    32

Chain C from PDB  Type:PROTEIN  Length:251
 aligned with NNMT_HUMAN | P40261 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:256
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254      
           NNMT_HUMAN     5 FTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
               SCOP domains d2iipc_ C: automated m     atches                                                                                                                                                                                                                                SCOP domains
               CATH domains 2iipC00 C:5-260 Vaccin     ia Virus protein VP39                                                                                                                                                                                                                 CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhh.-----hhhhhhhhhhhhhhhhhhhh....eeeeeee.....hhhhhhhhh.eeeeeeee.hhhhhhhhhhhhhh......hhhhhhhhhhhh....hhhhhhhhhhhheeeeee................eeeeeee.hhhhhh.hhhhhhhhhhhhhh.eeeeeeeeeeee....eeee..eeee....hhhhhhhhhhhh.eeeeeeeee.............eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ---SAM_MT_NNMT_PNMT_TEMT  PDB: C:8-260 UniProt: 8-262                                                                                                                                                                                                            PROSITE (1)
                PROSITE (2) ------------------------------------------------------NNMT_PNMT_TEMT   ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: C:5-52 (gaps) UniProt: 1-52      --------------------------------------------------------------------Exon 1.3  PDB: C:121-260 UniProt: 121-264 [INCOMPLETE]                                                                                       Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.2  PDB: C:52-121 UniProt: 52-121                               ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2iip C   5 FTSKDTYLSHFNPRDYLEKYYK-----SAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
                                    14        24 |     |34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254      
                                                26    32

Chain D from PDB  Type:PROTEIN  Length:251
 aligned with NNMT_HUMAN | P40261 from UniProtKB/Swiss-Prot  Length:264

    Alignment length:257
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       
           NNMT_HUMAN     4 GFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
               SCOP domains d2iipd_ D: automated m      atches                                                                                                                                                                                                                                SCOP domains
               CATH domains 2iipD00 D:4-260 Vaccin      ia Virus protein VP39                                                                                                                                                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhh------hhhhhhhhhhhhhhhhhhhh....eeeeee......hhhhhhhhhheeeeeeee.hhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhheeeeee................eeeeeee.hhhhhh.hhhhhhhhhhhhhh.eeeeeeeeeeee....eeee..eeee....hhhhhhhhhhhh.eeeeeeeee.............eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ----SAM_MT_NNMT_PNMT_TEMT  PDB: D:8-260 UniProt: 8-262                                                                                                                                                                                                            PROSITE (1)
                PROSITE (2) -------------------------------------------------------NNMT_PNMT_TEMT   ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
           Transcript 1 (1) Exon 1.1  PDB: D:4-52 (gaps) UniProt: 1-52       --------------------------------------------------------------------Exon 1.3  PDB: D:121-260 UniProt: 121-264 [INCOMPLETE]                                                                                       Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------Exon 1.2  PDB: D:52-121 UniProt: 52-121                               ------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1 (2)
                 2iip D   4 GFTSKDTYLSHFNPRDYLEKYY------SAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKAAPAAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL 260
                                    13        23 |      33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       
                                                25     32

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: S-adenosyl-L-methionine-dependent methyltransferases (533)

Superfamily: S-adenosyl-L-methionine-dependent methyltransferases (533)

Family: automated matches (94)

Protein domain: automated matches (94)

Human (Homo sapiens) [TaxId: 9606] (7)

1a	d2iipa_	A:
1b	d2iipb_	B:
1c	d2iipc_	C:
1d	d2iipd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: Vaccinia Virus protein VP39 (378)

Human (Homo sapiens) (49)

1a	2iipC00	C:5-260
1b	2iipD00	D:4-260
1c	2iipB00	B:-8-260
1d	2iipA00	A:-9-260

(no "Pfam Domain" information available for 2IIP)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (NNMT_HUMAN | P40261)

molecular function
	GO:0008168	methyltransferase activity	Catalysis of the transfer of a methyl group to an acceptor molecule.
	GO:0008112	nicotinamide N-methyltransferase activity	Catalysis of the reaction: S-adenosyl-L-methionine(1+) + nicotinamide = 1-methylnicotinamide + S-adenosyl-L-homocysteine.
	GO:0030760	pyridine N-methyltransferase activity	Catalysis of the reaction: S-adenosyl-L-methionine(1+) + pyridine = N-methylpyridinium + S-adenosyl-L-homocysteine.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0031100	animal organ regeneration	The regrowth of a lost or destroyed animal organ.
	GO:0032259	methylation	The process in which a methyl group is covalently attached to a molecule.
	GO:0042493	response to drug	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
	GO:0010243	response to organonitrogen compound	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organonitrogen stimulus. An organonitrogen compound is formally a compound containing at least one carbon-nitrogen bond.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SAH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2iip)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format \| Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2iip
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	NNMT_HUMAN \| P40261
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.1.1.1
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	NNMT_HUMAN \| P40261
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	NNMT_HUMAN \| P40261	:	3rod

(no "Related Entries Specified in the PDB File" available for 2IIP)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 8)

Exons (3, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (10, 18)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File