Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF TT0030 FROM THERMUS THERMOPHILUS
 
Authors :  J. Zhu, J. Huang, G. Stepanyuk, L. Chen, J. Chang, M. Zhao, H. Xu, Z. J. Liu, J. P. Rose, B. C. Wang, Southeast Collaboratory For Structural Genomics (Secsg)
Date :  19 Sep 06  (Deposition) - 14 Nov 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (4x)
Keywords :  Tt0030, Thermus Thermophilus, Structural Genomics, Psi, Protein Structure Initiative, Southeast Collaboratory For Structural Genomics, Secsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Zhu, J. Huang, G. Stepanyuk, L. Chen, J. Chang, M. Zhao, H. Xu, Z. J. Liu, J. P. Rose, B. C. Wang
Crystal Structure Of Tt0030 From Thermus Thermophilus At 1. 6 Angstroms Resolution
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN TT0030
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET16
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: TT0030
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 274

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (4x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2IEL)

(-) Sites  (0, 0)

(no "Site" information available for 2IEL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2IEL)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2IEL)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2IEL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2IEL)

(-) Exons   (0, 0)

(no "Exon" information available for 2IEL)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:132
 aligned with Q72LM7_THET2 | Q72LM7 from UniProtKB/TrEMBL  Length:138

    Alignment length:134
                                    11        21        31        41        51        61        71        81        91       101       111       121       131    
         Q72LM7_THET2     2 ARYLVVAHRTAKSPELAAKLKELLAQDPEARFVLLVPAVPPPGWVYEENEVRRRAEEEAAAAKRALEAQGIPVEEAKAGDISPLLAIEEELLAHPGAYQAIVLSTLPPGPSRWLRLDVHTQAERFGLPVIHVIA 135
               SCOP domains d2iela1 A:2-135 Hypothetical protein TTC0031                                                                                           SCOP domains
               CATH domains 2ielA00 A:2-135 Tyrosyl-Transfer RNA Synthetas  e , subunit E, domain 1                                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeee......hhhhhhhhhhhhhhh...eeeeeeeee.......--hhhhhhhhhhhhhhhhhhhh......eeeeee.hhhhhhhhhhhhh.....eeeeee.....hhhhhhhhhhhhhhhh..eeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2iel A   2 ARYLVVAHRTAKSPELAAKLKELLAQDPEARFVLLVPAVPPPGWVY--NEVRRRAEEEAAAAKRALEAQGIPVEEAKAGDISPLLAIEEELLAHPGAYQGIVLSTLPPGLSRWLRLDVHTQAERFGLPVIHVIA 135
                                    11        21        31        41     |  51        61        71        81        91       101       111       121       131    
                                                                        47 50                                                                                     


Chain B from PDB  Type:PROTEIN  Length:127
 aligned with Q72LM7_THET2 | Q72LM7 from UniProtKB/TrEMBL  Length:138

    Alignment length:134
                                    12        22        32        42        52        62        72        82        92       102       112       122       132    
         Q72LM7_THET2     3 RYLVVAHRTAKSPELAAKLKELLAQDPEARFVLLVPAVPPPGWVYEENEVRRRAEEEAAAAKRALEAQGIPVEEAKAGDISPLLAIEEELLAHPGAYQAIVLSTLPPGPSRWLRLDVHTQAERFGLPVIHVIAQ 136
               SCOP domains d2ielb_ B: Hypothetica      l protein TTC0031                                                                                          SCOP domains
               CATH domains 2ielB00 B:3-136 Tyrosy      l-Transfer RNA Sy nthetase , subunit E, domain 1                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee.hhhhhhhhhhhhhhhh------..eeeeeeee.......-hhhhhhhhhhhhhhhhhhhhh......eeeeee.hhhhhhhhhhhhh.....eeeeee.....hhhhhhhhhhhhhhhh..eeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2iel B   3 RYLVVAHRTAKSPELAAKLKEL------ARFVLLVPAVPPPGWVY-ENEVRRRAEEEAAAAKRALEAQGIPVEEAKAGDISPLLAIEEELLAHPGAYQGIVLSTLPPGLSRWLRLDVHTQAERFGLPVIHVIAQ 136
                                    12        22 |      32        42    | | 52        62        72        82        92       102       112       122       132    
                                                24     31              47 |                                                                                       
                                                                         49
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2IEL)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2IEL)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2iel)
 
  Sites
(no "Sites" information available for 2iel)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2iel)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2iel
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q72LM7_THET2 | Q72LM7
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q72LM7_THET2 | Q72LM7
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2IEL)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2IEL)