Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theor.Model - manually
(-)Theoretical Model
collapse expand < >
Image Theor.Model - manually
Theor.Model - manually  (Jmol Viewer)
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  HOMOLOGY MODELLING OF PGS25, OOKINETE SURFACE PROTEIN FROM PLASMODIUM GALLINACEUM
 
Authors :  B. Sharma
Date :  13 Sep 06  (Deposition) - 10 Oct 06  (Release) - 10 Oct 06  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  _
Keywords :  Homology Modelling (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  

PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN
    Chains: _
    Engineered: YES
    Fragment: MATURE PROTEIN
    Gene: NONE
    Organism Scientific: PLASMODIUM GALLINACEUM

 Structural Features

(-) Chains, Units

  
Theoretical Model : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2ICM)

(-) Sites  (0, 0)

(no "Site" information available for 2ICM)

(-) SS Bonds  (11, 11)

Theoretical Model
No.Residues
1 :8 - :22
2 :24 - :36
3 :42 - :57
4 :51 - :69
5 :71 - :82
6 :87 - :97
7 :92 - :110
8 :112 - :126
9 :134 - :145
10 :138 - :154
11 :156 - :169

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2ICM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2ICM)

(-) PROSITE Motifs  (1, 3)

Theoretical Model (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EGF_2PS01186 EGF-like domain signature 2.OS25_PLAGA43-57
90-103
175-190		  3_:22-36
_:69-82
_:154-169

(-) Exons   (0, 0)

(no "Exon" information available for 2ICM)

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain _ from PDB  Type:PROTEIN  Length:172
 aligned with OS25_PLAGA | P13401 from UniProtKB/Swiss-Prot  Length:215

    Alignment length:172
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191  
           OS25_PLAGA    22 KVTENTICKDGFLIQMSNHFECNCNPGFVLTSESTCENKVECNANSLDKRCGDFSKCAYKDLQQKELTCKCIDGYDLEESICVPNECKNFRCESGKCVLDPKQEAKIPMCSCFIGIVPSKENNNTCTIEGQTECTLKCTKENETCKKTSGIYKCDCKDGYTFDKEENACISF 193
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..........eeeee....eeeee....ee.....ee............eee..eeeee.......eeeee...eee....eee.hhh......eeeeeehhhhh.eeeeee...ee..........ee.............eeeeee..eeeeee....eee....eee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------EGF_2  PDB: -  --------------------------------EGF_2  PDB: - -----------------------------------------------------------------------EGF_2  PDB: -   --- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2icm _   1 KVTENTICKDGFLIQMSNHFECNCNPGFVLTSESTCENKVECNANSLDKRCGDFSKCAYKDLQQKELTCKCIDGYDLEESICVPNECKNFRCESGKCVLDPKQEAKIPMCSCFIGIVPSKENNNTCTIEGQTECTLKCTKENETCKKTSGIYKCDCKDGYTFDKEENACISF 172
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2ICM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2ICM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2ICM)

(-) Gene Ontology  (4, 4)

Theoretical Model(hide GO term definitions)
Chain   (OS25_PLAGA | P13401)
cellular component
    GO:0031225    anchored component of membrane    The component of a membrane consisting of the gene products that are tethered to the membrane only by a covalently attached anchor, such as a lipid group that is embedded in the membrane. Gene products with peptide sequences that are embedded in the membrane are excluded from this grouping.
    GO:0009986    cell surface    The external part of the cell wall and/or plasma membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2icm)
 
  Sites
(no "Sites" information available for 2icm)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2icm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2icm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  OS25_PLAGA | P13401
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  OS25_PLAGA | P13401
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2ICM)

(-) Related Entries Specified in the PDB File

1z27 USED AS A TEMPLATE FOR MODELLING