Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MALTOSE TRANSACETYLASE FROM GEOBACILLUS KAUSTOPHILUS
 
Authors :  Z. J. Liu, Y. Li, L. Chen, J. Zhu, J. P. Rose, A. Ebihara, S. Yokoyama, B. C. Wang, Southeast Collaboratory For Structural Genomics (Secsg), Riken Structural Genomics, Riken Structural Genomics/Proteomics Initiative (Rsgi)
Date :  12 Sep 06  (Deposition) - 07 Nov 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.78
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Structural Genomics, Psi, Protein Structure Initiative, Southeast Collaboratory For Structural Genomics, Secsg, Riken Genomics Sciences Center, Riken Structural Genomics/Proteomics Initiative, Rsgi, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. J. Liu, Y. Li, L. Chen, J. Zhu, J. P. Rose, A. Ebihara, S. Yokoyama, B. C. Wang
Crystal Structure Of Maltose Transacetylase From Geobacillus Kaustophilus At 1. 78 Angstrom Resolution
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - MALTOSE TRANSACETYLASE
    Chains: A, B, C
    EC Number: 2.3.1.79
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET-15B
    Expression System Strain: BL21-CODONPLUS(DE3)-RIL
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: GKB08
    Organism Scientific: GEOBACILLUS KAUSTOPHILUS
    Organism Taxid: 1462
    Synonym: MALTOSE O-ACETYLTRANSFERASE

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2IC7)

(-) Sites  (0, 0)

(no "Site" information available for 2IC7)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2IC7)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Pro A:65 -Asn A:66
2Asn A:176 -Pro A:177
3Pro B:65 -Asn B:66
4Asn B:176 -Pro B:177
5Pro C:65 -Asn C:66
6Asn C:176 -Pro C:177

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2IC7)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2IC7)

(-) Exons   (0, 0)

(no "Exon" information available for 2IC7)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:185
 aligned with Q75TD0_GEOKU | Q75TD0 from UniProtKB/TrEMBL  Length:185

    Alignment length:185
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     
         Q75TD0_GEOKU     1 MKSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKWLK 185
               SCOP domains d2ic7a_ A: automated matches                                                                                                                                                              SCOP domains
               CATH domains 2ic7A00 A:1-185 Hexapeptide repeat proteins                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh......eee...eee.....eee...eee...eeee....eee....ee....eee.ee...hhhhhhh...ee..eee....ee....ee....ee....ee....ee.......eeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ic7 A   1 MKSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKWLK 185
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     


Chain B from PDB  Type:PROTEIN  Length:185
 aligned with Q75TD0_GEOKU | Q75TD0 from UniProtKB/TrEMBL  Length:185

    Alignment length:185
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     
         Q75TD0_GEOKU     1 MKSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKWLK 185
               SCOP domains d2ic7b_ B: automated matches                                                                                                                                                              SCOP domains
               CATH domains 2ic7B00 B:1-185 Hexapeptide repeat proteins                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh......eee...eee.....ee....eee...eeee....eee....ee....eee.ee...hhhhhhh...ee..eee....ee....ee....ee....ee....ee.......eeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ic7 B   1 MKSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKWLK 185
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     


Chain C from PDB  Type:PROTEIN  Length:185
 aligned with Q75TD0_GEOKU | Q75TD0 from UniProtKB/TrEMBL  Length:185

    Alignment length:185
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180     
         Q75TD0_GEOKU     1 MKSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKWLK 185
               SCOP domains d2ic7c_ C: automated matches                                                                                                                                                              SCOP domains
               CATH domains 2ic7C00 C:1-185 Hexapeptide repeat proteins                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhh......hhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhh......eee...eee.....eee...eee...eeee....eee....ee....eee.ee...hhhhhhh...ee..eee....ee....ee....ee....ee....ee.......eeee....eeeee.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ic7 C   1 MKSEKEKMLAGHLYNPADLELVKERERARRLVRLYNETLETEYDKRTGLLKELFGSTGERLFIEPNFRCDYGYNIHVGENFFMNFDGVILDVCEVRIGDHCFIGPGVHIYTATHPLDPHERNSGLEYGKPVVIGHNVWIGGRAVINPGVTIGDNAVIASGAVVTKDVPANAVVGGNPAKVIKWLK 185
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2IC7)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (Q75TD0_GEOKU | Q75TD0)
molecular function
    GO:0016407    acetyltransferase activity    Catalysis of the transfer of an acetyl group to an acceptor molecule.
    GO:0008925    maltose O-acetyltransferase activity    Catalysis of the reaction: acetyl-CoA + maltose = CoA + acetyl-maltose.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2ic7)
 
  Sites
(no "Sites" information available for 2ic7)
 
  Cis Peptide Bonds
    Asn A:176 - Pro A:177   [ RasMol ]  
    Asn B:176 - Pro B:177   [ RasMol ]  
    Asn C:176 - Pro C:177   [ RasMol ]  
    Pro A:65 - Asn A:66   [ RasMol ]  
    Pro B:65 - Asn B:66   [ RasMol ]  
    Pro C:65 - Asn C:66   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ic7
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q75TD0_GEOKU | Q75TD0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.79
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q75TD0_GEOKU | Q75TD0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q75TD0_GEOKU | Q75TD0: 2p2o

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2IC7)