2IBG - JenaLib

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:214
 aligned with IHOG_DROME | Q9VM64 from UniProtKB/Swiss-Prot  Length:886

    Alignment length:214
                                   473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673    
           IHOG_DROME   464 QMYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRPK 677
               SCOP domains --d2ibga2 A:466-572 Hedgehog receptor iHog                                                                   d2ibga1 A:573-667 Hedgehog receptor iHog                                                       ---------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeee..eeeeeeeee......eeeeeeeeee.......ee....ee..........eeeeeeee.......eeeeeeeeee....eee......ee.............ee..........eeeeee.....hhhhh.eeeeeeee.......eeeeee.....eeee.......eeeeeeeee...........eeee..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---FN3  PDB: A:467-573 UniProt: 467-573                                                                       -------FN3  PDB: A:581-676 UniProt: 581-676                                                            - PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ibg A 464 STYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRPK 677
                                   473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673

Chain B from PDB  Type:PROTEIN  Length:213
 aligned with IHOG_DROME | Q9VM64 from UniProtKB/Swiss-Prot  Length:886

    Alignment length:213
                                   473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673   
           IHOG_DROME   464 QMYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRP 676
               SCOP domains d2ibgb2 B:464-572 Hedgehog receptor iHog                                                                     d2ibgb1 B:573-676 Hedgehog receptor iHog                                                                 SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeee..eeeeeeeee......eeeeeeeeee.......ee....ee..........eeeeeeee.......eeeeeeeeee....eee......ee..hhhhh......ee...eeee..eeeeeee.....hhhhh.eeeeeeee.......eeeeee.....eeee.......eeeeeeeee...........eeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---FN3  PDB: B:467-573 UniProt: 467-573                                                                       -------FN3  PDB: B:581-676 UniProt: 581-676                                                             PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ibg B 464 STYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRP 676
                                   473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673

Chain C from PDB  Type:PROTEIN  Length:213
 aligned with IHOG_DROME | Q9VM64 from UniProtKB/Swiss-Prot  Length:886

    Alignment length:213
                                   473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673   
           IHOG_DROME   464 QMYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRP 676
               SCOP domains d2ibgc2 C:464-572 Hedgehog receptor iHog                                                                     d2ibgc1 C:573-676 Hedgehog receptor iHog                                                                 SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeee..eeeeeeeee......eeeeeeeeee.......ee....ee..........eeeeeeee.......eeeeeeeeee....eee......ee.............ee..........eeeeee.....hhhhh.eeeeeeee.......eeeeee.....eeee.......eeeeeeeee...........eeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---FN3  PDB: C:467-573 UniProt: 467-573                                                                       -------FN3  PDB: C:581-676 UniProt: 581-676                                                             PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ibg C 464 STYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRP 676
                                   473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673

Chain D from PDB  Type:PROTEIN  Length:213
 aligned with IHOG_DROME | Q9VM64 from UniProtKB/Swiss-Prot  Length:886

    Alignment length:213
                                   473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673   
           IHOG_DROME   464 QMYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRP 676
               SCOP domains d2ibgd2 D:464-572 Hedgehog receptor iHog                                                                     d2ibgd1 D:573-676 Hedgehog receptor iHog                                                                 SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeee..eeeeeeeee......eeeeeeeeee.......ee....ee..........eeeeeeee.......eeeeeeeeee....eee......ee.............eeeeeeeee..eeeeeee...........eeeeeeee.......eeeeee.....eeee.......eeeeeeeee...........eeee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---FN3  PDB: D:467-573 UniProt: 467-573                                                                       -------FN3  PDB: D:581-676 UniProt: 581-676                                                             PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ibg D 464 STYPPTPPNVTRLSDESVMLRWMVPRNDGLPIVIFKVQYRMVGKRKNWQTTNDNIPYGKPKWNSELGKSFTASVTDLKPQHTYRFRILAVYSNNDNKESNTSAKFYLQPGAALDPMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSFSAASASEFSALKQGRTQRP 676
                                   473       483       493       503       513       523       533       543       553       563       573       583       593       603       613       623       633       643       653       663       673

Chain E from PDB  Type:PROTEIN  Length:142
 aligned with HH_DROME | Q02936 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:149
                                   109       119       129       139       149       159       169       179       189       199       209       219       229       239         
             HH_DROME   100 YPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEEGTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKSD 248
               SCOP domains d2ibge1 E:100-248 Hedgehog                                                                                                                            SCOP domains
               CATH domains 2ibgE00 E:100-248  [code=3.30.1380.10, no name d       efined]                                                                                        CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......ee.....................hhhhhhhee.....eee.-------..eehhhhhhhhhhhhhhhhhhh....eeeee...........hhhhhh.eeeeee...hhhhhhhhhhhhhhhh..eee......eeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ibg E 100 YPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFR-------DRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKSD 248
                                   109       119       129       139       | -     | 159       169       179       189       199       209       219       229       239         
                                                                         147     155

Chain F from PDB  Type:PROTEIN  Length:132
 aligned with HH_DROME | Q02936 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:148
                                   108       118       128       138       148       158       168       178       188       198       208       218       228       238        
             HH_DROME    99 LYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEEGTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVK 246
               SCOP domains d2ibgf_ F: Hedgehog                                                                                                                                  SCOP domains
               CATH domains 2ibgF00 F:99-246  [code=3.30.1380.10, no name def       ined]                                                                                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........ee.......................hhhhhee.....eee.-------..eehhhhhhhhhhhhhhhhhhh....eeeee.---------.hhhhhh.eeeeee...hhhhhhhhhhhhhhh...eee......eeee.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ibg F  99 LYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFR-------DRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTES---------ESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVK 246
                                   108       118       128       138        |-      |158       168       178        |-       198       208       218       228       238        
                                                                          147     155                             187       197

Chain G from PDB  Type:PROTEIN  Length:134
 aligned with HH_DROME | Q02936 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:149
                                   108       118       128       138       148       158       168       178       188       198       208       218       228       238         
             HH_DROME    99 LYPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEEGTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKS 247
               SCOP domains d2ibgg_ G: Hedgehog                                                                                                                                   SCOP domains
               CATH domains 2ibgG00 G:99-247  [code=3.3       0.1380.10, no n        ame defined]                                                                                 CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........ee.................-------....ee.....eee.--------.eehhhhhhhhhhhhhhhhhhh....eeeee...........hhhhhh.eeeeee...hhhhhhhhhhhhhhh...eeeeee..eeeee... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ibg G  99 LYPLVLKQTIPNLSEYTNSASGPLEGV-------FKDLVPNYNRDILFR--------RLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKS 247
                                   108       118      |  -    |  138        |-       158       168       178       188       198       208       218       228       238         
                                                    125     133           147      156

Chain H from PDB  Type:PROTEIN  Length:140
 aligned with HH_DROME | Q02936 from UniProtKB/Swiss-Prot  Length:471

    Alignment length:149
                                   109       119       129       139       149       159       169       179       189       199       209       219       229       239         
             HH_DROME   100 YPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILFRDEEGTGADRLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKSD 248
               SCOP domains d2ibgh_ H: Hedgehog                                                                                                                                   SCOP domains
               CATH domains 2ibgH00 H:100-248  [code=3.30.1380.10, no name          defined]                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......ee.....................hhhhhhhee.....ee.---------.eehhhhhhhhhhhhhhhhhhh....eeeee............hhhhh.eeeeee...hhhhhhhhhhhhhhhh..eee......eeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ibg H 100 YPLVLKQTIPNLSEYTNSASGPLEGVIRRDSPKFKDLVPNYNRDILF---------RLMSKRCKEKLNVLAYSVMNEWPGIRLLVTESWDEDYHHGQESLHYEGRAVTIATSDRDQSKYGMLARLAVEAGFDWVSYVSRRHIYCSVKSD 248
                                   109       119       129       139      |  -      |159       169       179       189       199       209       219       229       239         
                                                                        146       156

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (IHOG_DROME | Q9VM64)

molecular function
	GO:0097108	hedgehog family protein binding	Interacting selectively and non-covalently with a member of the hedgehog protein family, signaling proteins involved in development.
	GO:0008158	hedgehog receptor activity	Combining with a member of the hedgehog protein family and transmitting the signal across the membrane to initiate a change in cell activity.
	GO:0008201	heparin binding	Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0048749	compound eye development	The process whose specific outcome is the progression of the compound eye over time, from its formation to the mature structure. The compound eye is an organ of sight that contains multiple repeating units, often arranged hexagonally. Each unit has its own lens and photoreceptor cell(s) and can generate either a single pixelated image or multiple images, per eye.
	GO:0001751	compound eye photoreceptor cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of an eye photoreceptor cell.
	GO:0035017	cuticle pattern formation	The regionalization process that gives rise to the patterns of cell differentiation in the cuticle.
	GO:0045746	negative regulation of Notch signaling pathway	Any process that stops, prevents, or reduces the frequency, rate or extent of the Notch signaling pathway.
	GO:0045880	positive regulation of smoothened signaling pathway	Any process that activates or increases the frequency, rate or extent of smoothened signaling.
	GO:0008589	regulation of smoothened signaling pathway	Any process that modulates the frequency, rate or extent of smoothened signaling.
	GO:0007224	smoothened signaling pathway	A series of molecular signals generated as a consequence of activation of the transmembrane protein Smoothened.
	GO:0035222	wing disc pattern formation	The process giving rise to the pattern of cell differentiation in the wing imaginal disc.
cellular component
	GO:0009986	cell surface	The external part of the cell wall and/or plasma membrane.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain E,F,G,H (HH_DROME | Q02936)

molecular function
	GO:0004175	endopeptidase activity	Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0016015	morphogen activity	Acts as a trigger for a pattern specification process when present at a specific concentration within a gradient.
	GO:0005113	patched binding	Interacting selectively and non-covalently with the patched (ptc) protein, a receptor for hedgehog proteins.
	GO:0008233	peptidase activity	Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005119	smoothened binding	Interacting selectively and non-covalently with the smoothened (smo) protein, which interacts with patched to transmit hedgehog signals.
biological process
	GO:0001746	Bolwig's organ morphogenesis	The morphogenetic process in which the anatomical structures of the larval eye in Drosophila are generated and organized. The larval eye in Drosophila is a relatively simple sensory system composed of Bolwig's organs: two clusters, each composed of 12 photoreceptor cells from which axons extend in a single fascicle to the brain.
	GO:0045464	R8 cell fate specification	The process in which a cell becomes capable of differentiating autonomously into an R8 cell in an environment that is neutral with respect to the developmental pathway; upon specification, the cell fate can be reversed.
	GO:0007487	analia development	The process whose specific outcome is the progression of the analia over time, from its formation to the mature structure. The analia is the posterior-most vertral appendage that develops from the genital disc. An example of this process is analia development in Drosophila melanogaster.
	GO:0009653	anatomical structure morphogenesis	The process in which anatomical structures are generated and organized. Morphogenesis pertains to the creation of form.
	GO:0021960	anterior commissure morphogenesis	Generation of a long process of a CNS neuron, that carries efferent (outgoing) action potentials from the cell body in one half of the cerebral cortex towards target cells in the contralateral half. This axonal process is a member of those that make up the anterior commissure, a small midline fiber tract that lies at the anterior end of the corpus callosum.
	GO:0035288	anterior head segmentation	Partitioning the insect head anlage into procephalic (labral, (ocular), antennal and intercalary) segments. The procephalic segments lie anterior to the gnathal (posterior head) segments, and are pattered by different segmentation gene cascades to the abdominal, thoracic and posterior head (gnathal) segments.
	GO:0008595	anterior/posterior axis specification, embryo	The specification of the anterior/posterior axis of the embryo by the products of genes expressed maternally and genes expressed in the zygote.
	GO:0048099	anterior/posterior lineage restriction, imaginal disc	Formation and/or maintenance of a lineage boundary between anterior and posterior compartments that cells cannot cross, thus separating the populations of cells in each compartment.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0045168	cell-cell signaling involved in cell fate commitment	Signaling at long or short range between cells that results in the commitment of a cell to a certain fate.
	GO:0007386	compartment pattern specification	The regionalization process in which embryonic segments are divided into compartments that will result in differences in cell differentiation.
	GO:0001745	compound eye morphogenesis	The morphogenetic process in which the anatomical structures of the compound eye are generated and organized. The adult compound eye is a precise assembly of 700-800 ommatidia. Each ommatidium is composed of 20 cells, identified by cell type and position. An example of compound eye morphogenesis is found in Drosophila melanogaster.
	GO:0001751	compound eye photoreceptor cell differentiation	The process in which a relatively unspecialized cell acquires the specialized features of an eye photoreceptor cell.
	GO:0035231	cytoneme assembly	Formation of a cytoneme, a long, thin and polarized actin-based cytoplasmic extension that projects from a cell.
	GO:0048066	developmental pigmentation	The developmental process that results in the deposition of coloring matter in an organism, tissue or cell.
	GO:0007398	ectoderm development	The process whose specific outcome is the progression of the ectoderm over time, from its formation to the mature structure. In animal embryos, the ectoderm is the outer germ layer of the embryo, formed during gastrulation.
	GO:0009880	embryonic pattern specification	The process that results in the patterns of cell differentiation that will arise in an embryo.
	GO:0008544	epidermis development	The process whose specific outcome is the progression of the epidermis over time, from its formation to the mature structure. The epidermis is the outer epithelial layer of an animal, it may be a single layer that produces an extracellular material (e.g. the cuticle of arthropods) or a complex stratified squamous epithelium, as in the case of many vertebrate species.
	GO:0007427	epithelial cell migration, open tracheal system	The orderly movement of epithelial cells during development of an open tracheal system. An example of this is found in Drosophila melanogaster.
	GO:0048592	eye morphogenesis	The process in which the anatomical structures of the eye are generated and organized.
	GO:0007440	foregut morphogenesis	The process in which the anatomical structures of the foregut are generated and organized.
	GO:0035224	genital disc anterior/posterior pattern formation	The establishment, maintenance and elaboration of the anterior/posterior axis of the genital disc. An anterior and posterior compartment form in each of the three genital disc primoridia (the female genital disc primordium, the male genital disc primordium and the anal primordium).
	GO:0035215	genital disc development	Progression of the genital imaginal disc over time, from its initial formation through to its metamorphosis to form the adult terminalia, comprising the entire set of internal and external genitalia and analia. Both sexes of Drosophila have a single genital disc formed from the female and male genital primordia, and the anal primordium. The anal primordium develops in both sexes, forming either male or female analia. However, only one of the genital primordia develops in each sex, forming either the male or the female genitalia.
	GO:0035232	germ cell attraction	The directed movement of a germ cell from their site of production to the gonad, through the attraction of cells towards their target.
	GO:0008354	germ cell migration	The orderly movement of a cell specialized to produce haploid gametes through the embryo from its site of production to the place where the gonads will form.
	GO:0042078	germ-line stem cell division	The self-renewing division of a germline stem cell to produce a daughter stem cell and a daughter germ cell, which will divide to form the gametes.
	GO:0008347	glial cell migration	The orderly movement of a glial cell, non-neuronal cells that provide support and nutrition, maintain homeostasis, form myelin, and participate in signal transmission in the nervous system.
	GO:0007506	gonadal mesoderm development	The process whose specific outcome is the progression of the gonadal mesoderm over time, from its formation to the mature structure. The gonadal mesoderm is the middle layer of the three primary germ layers of the embryo which will go on to form the gonads of the organism.
	GO:0040007	growth	The increase in size or mass of an entire organism, a part of an organism or a cell.
	GO:0007507	heart development	The process whose specific outcome is the progression of the heart over time, from its formation to the mature structure. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0060914	heart formation	The developmental process pertaining to the initial formation of the heart from unspecified parts. This process begins with the specific processes that contribute to the appearance of the heart field and the arrival of cardiac neural crest to the heart region. The process ends when the structural rudiment is recognizable.
	GO:0007442	hindgut morphogenesis	The process in which the anatomical structures of the hindgut are generated and organized.
	GO:0007446	imaginal disc growth	The increase in mass of imaginal discs by cell proliferation prior to metamorphosis. Imaginal discs are epithelial infoldings in the larvae of holometabolous insects that develop into adult structures (legs, antennae, wings, etc.) during metamorphosis from larval to adult form.
	GO:0007447	imaginal disc pattern formation	The regionalization process that results in defined areas of the imaginal disc that will undergo specific cell differentaiton. Imaginal discs are epithelial infoldings in the larvae of holometabolous insects that develop into adult appendages (legs, antennae, wings, etc.) during metamorphosis from larval to adult form.
	GO:0007474	imaginal disc-derived wing vein specification	The regionalization process in which the area of a imaginal disc-derived wing that will form a wing vein is specified.
	GO:0016539	intein-mediated protein splicing	The removal of an internal amino acid sequence (an intein) from a protein during protein maturation; the excision of inteins is precise and the N- and C-terminal exteins are joined by a normal peptide bond. Protein splicing involves 4 nucleophilic displacements by the 3 conserved splice junction residues.
	GO:0035217	labial disc development	Progression of the labial imaginal disc over time, from its initial formation through to its metamorphosis to form adult structures including parts of the proboscis.
	GO:0007478	leg disc morphogenesis	The process in which the anatomical structures derived from the leg disc are generated and organized. This includes the transformation of a leg imaginal disc from a monolayered epithelium in the larvae of holometabolous insects into recognizable adult structures including the leg, coxa and ventral thoracic pleura.
	GO:0007498	mesoderm development	The process whose specific outcome is the progression of the mesoderm over time, from its formation to the mature structure. The mesoderm is the middle germ layer that develops into muscle, bone, cartilage, blood and connective tissue.
	GO:0016335	morphogenesis of larval imaginal disc epithelium	The process in which the anatomical structures of a larval imaginal disc epithelium are generated and organized.
	GO:0002385	mucosal immune response	An immune response taking place in mucosal tissues, including those of the intestinal tract, nasal and upper respiratory tract, and genital tract.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0031397	negative regulation of protein ubiquitination	Any process that stops, prevents, or reduces the frequency, rate or extent of the addition of ubiquitin groups to a protein.
	GO:0045861	negative regulation of proteolysis	Any process that stops, prevents, or reduces the frequency, rate or extent of the hydrolysis of a peptide bond or bonds within a protein.
	GO:0007424	open tracheal system development	The process whose specific outcome is the progression of an open tracheal system over time, from its formation to the mature structure. An open tracheal system is a respiratory system, a branched network of epithelial tubes that supplies oxygen to target tissues via spiracles. An example of this is found in Drosophila melanogaster.
	GO:0030707	ovarian follicle cell development	The process that occurs during oogenesis involving the ovarian follicle cells, somatic cells which surround the germ cells of an ovary. An example of this is found in Drosophila melanogaster.
	GO:0030713	ovarian follicle cell stalk formation	Development of ovarian follicle cells to create the interfollicular stalks that connect the egg chambers of progressive developmental stages. An example of this process is found in Drosophila melanogaster.
	GO:0007280	pole cell migration	The directed movement of a pole cell (germline progenitors in insects) from its site of production at the posterior pole of the embryo through to the site where the gonads will form.
	GO:0045743	positive regulation of fibroblast growth factor receptor signaling pathway	Any process that activates or increases the frequency, rate or extent of fibroblast growth factor receptor signaling pathway activity.
	GO:0007228	positive regulation of hh target transcription factor activity	Any process that increases the activity of a transcription factor that activates transcription of Hedgehog-target genes in response to Smoothened signaling. In Drosophila, Cubitus interruptus (Ci) is the only identified transcription factor so far in the Hedgehog signaling pathway. In vertebrates, members of the Gli protein family are activated in this way. Activation of the Gli/Ci transcription factor is distinct from its stabilization, when proteolytic cleavage is inhibited.
	GO:0045880	positive regulation of smoothened signaling pathway	Any process that activates or increases the frequency, rate or extent of smoothened signaling.
	GO:0042993	positive regulation of transcription factor import into nucleus	Any process that activates or increases the frequency, rate or extent of the movement of a transcription factor from the cytoplasm to the nucleus.
	GO:0035289	posterior head segmentation	Partitioning the posterior region of the insect head anlage into gnathal (mandibular, maxillary and labial) segments. Unlike the anterior head (procephalic) segments, formation of the posterior head (gnathal) segments occurs by a similar mechanism to trunk segmentation, where a cascade of gap genes, pair-rule genes and segment-polarity genes subdivide the embryo into progressively smaller domains.
	GO:0007458	progression of morphogenetic furrow involved in compound eye morphogenesis	The morphogenetic furrow is a dorsoventral indentation which sweeps anteriorly across the eye disc. Ommatidia begin to form along the furrow, resulting in a graded series of ommatidial development across the anterior/posterior axis of the disc.
	GO:0016540	protein autoprocessing	Processing which a protein carries out itself. This involves actions such as the autolytic removal of residues to generate the mature form of the protein.
	GO:0030908	protein splicing	The post-translational removal of peptide sequences from within a protein sequence.
	GO:0006508	proteolysis	The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
	GO:0042127	regulation of cell proliferation	Any process that modulates the frequency, rate or extent of cell proliferation.
	GO:2000274	regulation of epithelial cell migration, open tracheal system	Any process that modulates the frequency, rate or extent of epithelial cell migration, open tracheal system.
	GO:0007346	regulation of mitotic cell cycle	Any process that modulates the rate or extent of progress through the mitotic cell cycle.
	GO:0046620	regulation of organ growth	Any process that modulates the frequency, rate or extent of growth of an organ of an organism.
	GO:0042306	regulation of protein import into nucleus	Any process that modulates the frequency, rate or extent of movement of proteins from the cytoplasm to the nucleus.
	GO:0006357	regulation of transcription from RNA polymerase II promoter	Any process that modulates the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0007367	segment polarity determination	Division of the 14 parasegments of the embryo into anterior and posterior compartments; exemplified by the actions of the segment polarity gene products.
	GO:0007224	smoothened signaling pathway	A series of molecular signals generated as a consequence of activation of the transmembrane protein Smoothened.
	GO:0048103	somatic stem cell division	The self-renewing division of a somatic stem cell, a stem cell that can give rise to cell types of the body other than those of the germ-line.
	GO:0035277	spiracle morphogenesis, open tracheal system	The process in which the anatomical structures of a spiracle are generated and organized. Spiracles are the openings in the insect open tracheal system; externally they connect to the epidermis and internally they connect to the tracheal trunk.
	GO:0035290	trunk segmentation	Partitioning of the blastoderm embryo into trunk segmental units. In Drosophila, the trunk segments include thoracic segments and abdominal segments A1 to A8.
	GO:0007418	ventral midline development	The process whose specific outcome is the progression of the ventral midline over time, from its formation to the mature structure. In protostomes (such as insects, snails and worms) as well as deuterostomes (vertebrates), the midline is an embryonic region that functions in patterning of the adjacent nervous tissue. The ventral midline in insects is a cell population extending along the ventral surface of the embryo and is the region from which cells detach to form the ventrally located nerve cords. In vertebrates, the midline is originally located dorsally. During development, it folds inwards and becomes the ventral part of the dorsally located neural tube and is then called the ventral midline, or floor plate.
	GO:0048100	wing disc anterior/posterior pattern formation	The establishment, maintenance and elaboration of the anterior/posterior axis of the wing disc, a precursor to the wing.
	GO:0007473	wing disc proximal/distal pattern formation	The establishment, maintenance and elaboration of the proximal/distal axis of the wing disc, a precursor to the adult wing.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0030139	endocytic vesicle	A membrane-bounded intracellular vesicle formed by invagination of the plasma membrane around an extracellular substance. Endocytic vesicles fuse with early endosomes to deliver the cargo for further sorting.
	GO:0005768	endosome	A vacuole to which materials ingested by endocytosis are delivered.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 12)

Sites (12, 12)

SS Bonds (0, 0)

Cis Peptide Bonds (12, 12)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 8)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 12)

CATH Domains (1, 4)

Pfam Domains (0, 0)

Gene Ontology (98, 103)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File