Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF MONOOXYGENASE FROM AGROBACTERIUM TUMEFACIENS
 
Authors :  Y. Kim, X. Xu, H. Zheng, A. Joachimiak, A. Edwards, A. Savchenko, Midwes For Structural Genomics (Mcsg)
Date :  30 Aug 06  (Deposition) - 03 Oct 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.73
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Alpha-Beta, Tim Barrel, Helix-Bundle, Structural Genomics, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Kim, X. Xu, H. Zheng, A. Joachimiak, A. Edwards, A. Savchenko
The Crystal Structure Of Monooxygenase From Agrobacterium Tumefaciens
To Be Published 2006
PubMed: search

(-) Compounds

Molecule 1 - MONOOXYGENASE
    Atcc33970
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism ScientificAGROBACTERIUM TUMEFACIENS STR.
    Organism Taxid176299
    StrainC58
    SynonymAGR_C_4197P

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 18)

Asymmetric/Biological Unit (3, 18)
No.NameCountTypeFull Name
1MSE14Mod. Amino AcidSELENOMETHIONINE
2PEG1Ligand/IonDI(HYDROXYETHYL)ETHER
3SO43Ligand/IonSULFATE ION

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:220 , ARG B:112 , VAL B:179 , GLY B:180 , THR B:182 , SER B:185 , HOH B:1049 , HOH B:1058BINDING SITE FOR RESIDUE SO4 B 701
2AC2SOFTWAREARG A:112 , ALA A:178 , VAL A:179 , GLY A:180 , THR A:182 , SER A:185 , HOH A:802 , HOH A:967BINDING SITE FOR RESIDUE SO4 A 702
3AC3SOFTWAREGLY B:202 , GLY B:203 , ARG B:265 , TRP B:267 , ALA B:278 , ASN B:284 , HOH B:789 , HOH B:1036 , HOH B:1056BINDING SITE FOR RESIDUE SO4 B 703
4AC4SOFTWAREGLU A:49 , HIS A:50 , HIS A:51 , VAL A:82 , ARG A:112 , GLY A:113 , SER A:114 , PHE A:115 , ILE A:116 , GLU A:117 , SER A:118 , HOH A:717 , HOH A:969 , HOH A:998 , HOH A:1001BINDING SITE FOR RESIDUE PEG A 704

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2I7G)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Ala A:79 -Val A:80
2Tyr A:165 -Pro A:166
3Ala B:79 -Val B:80
4Tyr B:165 -Pro B:166

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2I7G)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2I7G)

(-) Exons   (0, 0)

(no "Exon" information available for 2I7G)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:344
 aligned with A9CI16_AGRFC | A9CI16 from UniProtKB/TrEMBL  Length:353

    Alignment length:344
                             1                                                                                                                                                                                                                                                                                                                                                      
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339    
         A9CI16_AGRFC     - -MELGLYTFADVNPNPADGRGPEGARRLRELLEEIELADQVGLDVFGLGEHHRPDYVVSSPSTVLAAAAVKTKNIRLTSAVSVLSSDDPVRVFQQFSTVDLLSNGRAEIMAGRGSFIESYPLFGYDLEDYDVLFAEKLDLLLALREQEVVTWSGTKHPAINGRGVYPRPLQERLPVWIAVGGTPQSVARAGAMGLPVALAIIGGEYRRFAPLFDLYHEAARRAGQEKTKLRTSINVHGFIADTTDKAADQFYGPQAEVMNRIGRERGWGPTNRAHFDAARGPEGNLFLGEPELVAEKIIKAHGVFKNDRFLLQMAIGLMPHDQIMRGIELYGTKVAPLVRKELT 343
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2i7gA00 A:0-343 FMN dependent fluorescent proteins                                                                                                                                                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..........hhhhhhhhhhhhhhhhhhhhhhh...eeee...........hhhhhhhhhhh.....eeee...hhhhhhhhhhhhhhhhhhhhh...eeeeee.....hhhhhhh.hhhhhhhhhhhhhhhhhhhhhh.eeee.......eeeee...........eeeee..hhhhhhhhhhh...eeeee...hhhhhhhhhhhhhhhhhhh..hhhhh.eeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.....eeehhhhhhhhhhhhhhhhh..eeeee......hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2i7g A   0 GmELGLYTFADVNPNPADGRGPEGARRLRELLEEIELADQVGLDVFGLGEHHRPDYVVSSPSTVLAAAAVKTKNIRLTSAVSVLSSDDPVRVFQQFSTVDLLSNGRAEImAGRGSFIESYPLFGYDLEDYDVLFAEKLDLLLALREQEVVTWSGTKHPAINGRGVYPRPLQERLPVWIAVGGTPQSVARAGAmGLPVALAIIGGEYRRFAPLFDLYHEAARRAGQEKTKLRTSINVHGFIADTTDKAADQFYGPQAEVmNRIGRERGWGPTNRAHFDAARGPEGNLFLGEPELVAEKIIKAHGVFKNDRFLLQmAIGLmPHDQImRGIELYGTKVAPLVRKELT 343
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189  |    199       209       219       229       239       249       259       269       279       289       299       309   |   319    |  329       339    
                             |                                                                                                         109-MSE                                                                            192-MSE                                                           258-MSE                                                313-MSE|     |                   
                             1-MSE                                                                                                                                                                                                                                                                                                                      318-MSE |                   
                                                                                                                                                                                                                                                                                                                                                              324-MSE               

Chain B from PDB  Type:PROTEIN  Length:345
 aligned with A9CI16_AGRFC | A9CI16 from UniProtKB/TrEMBL  Length:353

    Alignment length:345
                             1                                                                                                                                                                                                                                                                                                                                                       
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339     
         A9CI16_AGRFC     - -MELGLYTFADVNPNPADGRGPEGARRLRELLEEIELADQVGLDVFGLGEHHRPDYVVSSPSTVLAAAAVKTKNIRLTSAVSVLSSDDPVRVFQQFSTVDLLSNGRAEIMAGRGSFIESYPLFGYDLEDYDVLFAEKLDLLLALREQEVVTWSGTKHPAINGRGVYPRPLQERLPVWIAVGGTPQSVARAGAMGLPVALAIIGGEYRRFAPLFDLYHEAARRAGQEKTKLRTSINVHGFIADTTDKAADQFYGPQAEVMNRIGRERGWGPTNRAHFDAARGPEGNLFLGEPELVAEKIIKAHGVFKNDRFLLQMAIGLMPHDQIMRGIELYGTKVAPLVRKELTG 344
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2i7gB00 B:0-344 FMN dependent fluorescent proteins                                                                                                                                                                                                                                                                                                        CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee..........hhhhhhhhhhhhhhhhhhhhhhh...eeee...........hhhhhhhhhhh.....eeee...hhhhhhhhhhhhhhhhhhhhh...eeeee...hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.eeee.......eeeee...........eeeee..hhhhhhhhhhh...eeee....hhhhhhhhhhhhhhhhhhh........eeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhh.....eeehhhhhhhhhhhhhhhhh..eeeee......hhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2i7g B   0 GmELGLYTFADVNPNPADGRGPEGARRLRELLEEIELADQVGLDVFGLGEHHRPDYVVSSPSTVLAAAAVKTKNIRLTSAVSVLSSDDPVRVFQQFSTVDLLSNGRAEImAGRGSFIESYPLFGYDLEDYDVLFAEKLDLLLALREQEVVTWSGTKHPAINGRGVYPRPLQERLPVWIAVGGTPQSVARAGAmGLPVALAIIGGEYRRFAPLFDLYHEAARRAGQEKTKLRTSINVHGFIADTTDKAADQFYGPQAEVmNRIGRERGWGPTNRAHFDAARGPEGNLFLGEPELVAEKIIKAHGVFKNDRFLLQmAIGLmPHDQImRGIELYGTKVAPLVRKELTG 344
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189  |    199       209       219       229       239       249       259       269       279       289       299       309   |   319    |  329       339     
                             1-MSE                                                                                                     109-MSE                                                                            192-MSE                                                           258-MSE                                                313-MSE|     |                    
                                                                                                                                                                                                                                                                                                                                                        318-MSE |                    
                                                                                                                                                                                                                                                                                                                                                              324-MSE                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2I7G)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2I7G)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (A9CI16_AGRFC | A9CI16)
molecular function
    GO:0004497    monooxygenase activity    Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
    GO:0016705    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen    Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from each of two donors, and molecular oxygen is reduced or incorporated into a donor.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PEG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Ala A:79 - Val A:80   [ RasMol ]  
    Ala B:79 - Val B:80   [ RasMol ]  
    Tyr A:165 - Pro A:166   [ RasMol ]  
    Tyr B:165 - Pro B:166   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2i7g
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A9CI16_AGRFC | A9CI16
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  A9CI16_AGRFC | A9CI16
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2I7G)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2I7G)