|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 7)| Asymmetric/Biological Unit (4, 7) |
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2I6O) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2I6O) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2I6O) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2I6O) |
Exons (0, 0)| (no "Exon" information available for 2I6O) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:158 aligned with Q97VZ7_SULSO | Q97VZ7 from UniProtKB/TrEMBL Length:161 Alignment length:158 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 Q97VZ7_SULSO 1 MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDYYLSILKKNGLQPLHIPIPDGGVPSDSQFLTIMKWLLSEKEGNLVHCVGGIGRTGTILASYLILTEGLEVESAIDEVRLVRPGAVQTYEQEMFLLRVEGMRKSWLKNIY 158 SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2i6o A 1 MYWVRRKTIGGSGLPYTENEILEWRKEGVKRVLVLPEDWEIEESWGDKDYYLSILKKNGLQPLHIPIPDGGVPSDSQFLTIMKWLLSEKEGNLVHSVGGIGRTGTILASYLILTEGLEVESAIDEVRLVRPGAVQTYEQEMFLLRVEGMRKSWLKNIY 158 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150
Chain B from PDB Type:PROTEIN Length:5
SCOP domains ----- SCOP domains
CATH domains ----- CATH domains
Pfam domains ----- Pfam domains
SAPs(SNPs) ----- SAPs(SNPs)
PROSITE ----- PROSITE
Transcript ----- Transcript
2i6o B 171 NKyGN 175
|
173-PTR
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2I6O) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2I6O) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2I6O) |
Gene Ontology (6, 6)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (Q97VZ7_SULSO | Q97VZ7)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|