Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Theor.Model - manually
(-)Theoretical Model
collapse expand < >
Image Theor.Model - manually
Theor.Model - manually  (Jmol Viewer)
Image Theoretical Model
Theoretical Model  (Jmol Viewer)

(-) Description

Title :  O-METHYLTRANSFERASE5 OF STREPTOMYCES AVERMITILIS
 
Authors :  Yh Lim, Yh Park, Yd Yonn, Ys Lee, Jh Ahn
Date :  29 Aug 06  (Deposition) - 10 Oct 06  (Release) - 10 Oct 06  (Revision)
Method :  THEORETICAL MODEL
Resolution :  NOT APPLICABLE
Chains :  Theor. Model :  A
Keywords :  Alpha Helix, Beta Sheet (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Yh Lim, Yh Park, Yd Yoon, Ys Lee, Jh Ahn

PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - O-METHYLTRANSFERASE5 OF STREPTOMYCES AVERMITILIS
    ChainsA
    EngineeredYES
    Organism ScientificSTREPTOMYCES AVERMITILIS

 Structural Features

(-) Chains, Units

  
Theoretical Model 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2I6N)

(-) Sites  (0, 0)

(no "Site" information available for 2I6N)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2I6N)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2I6N)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2I6N)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2I6N)

(-) Exons   (0, 0)

(no "Exon" information available for 2I6N)

(-) Sequences/Alignments

Theoretical Model
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:224
 aligned with Q82B68_STRAW | Q82B68 from UniProtKB/TrEMBL  Length:224

    Alignment length:224
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220    
         Q82B68_STRAW     1 MSESQQLWDDVDDYFTTLLAPEDEALTAALRDSDAAGLPHINVAPNQGKLLQLLAEIQGARRILEIGTLGGYSTIWLGRALPRDGRLISFEYDAKHAEVARRNLARAGLDGISEVRVGPALESLPKLADERPEPFDLVFIDADKVNNPHYVEWALKLTRPGSLIVVDNVVRGGGVTDAGSTDPSVRGTRSALELIAEHPKLSGTAVQTVGSKGYDGFALARVLP 224
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............hhhhhhhhhhhh..hhhhhhhhhhhh.......hhhhhhhhhhhhhh..eeeee....hhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhheeeeeeeeee..............hhhhhhhhhhhhhhhhh..eeeeeee.........eeeeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2i6n A   1 MSESQQLWDDVDDYFTTLLAPEDEALTAALRDSDAAGLPHINVAPNQGKLLQLLAEIQGARRILEIGTLGGYSTIWLGRALPRDGRLISFEYDAKHAEVARRNLARAGLDGISEVRVGPALESLPKLADERPEPFDLVFIDADKVNNPHYVEWALKLTRPGSLIVVDNVVRGGGVTDAGSTDPSVRGTRSALELIAEHPKLSGTAVQTVGSKGYDGFALARVLP 224
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2I6N)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2I6N)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2I6N)

(-) Gene Ontology  (4, 4)

Theoretical Model(hide GO term definitions)
Chain A   (Q82B68_STRAW | Q82B68)
molecular function
    GO:0008171    O-methyltransferase activity    Catalysis of the transfer of a methyl group to the oxygen atom of an acceptor molecule.
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.

 Visualization

(-) Interactive Views

Theoretical Model
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2i6n)
 
  Sites
(no "Sites" information available for 2i6n)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2i6n)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2i6n
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q82B68_STRAW | Q82B68
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q82B68_STRAW | Q82B68
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2I6N)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2I6N)