2I4R - JenaLib

Title :   CRYSTAL STRUCTURE OF THE V-TYPE ATP SYNTHASE SUBUNIT F FROM ARCHAEOGLOBUS FULGIDUS. NESG TARGET GR52A.

Authors :   S. M. Vorobiev, M. Su, J. Seetharaman, L. Zhao, Y. Fang, K. Cunningham, L R. Xiao, T. B. Acton, G. T. Montelione, J. F. Hunt, L. Tong, Northeast S Genomics Consortium (Nesg)

Date :   22 Aug 06 (Deposition) - 29 Aug 06 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.80

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: A,B  (4x)

Keywords :   Nesg, Gr52A, Atp Synthesis, Hydrolase, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. M. Vorobiev, M. Su, J. Seetharaman, L. Zhao, Y. Fang, K. Cunningham, L. -C. Ma, T. B. Acton, G. T. Montelione, J. F. Hunt, L. Tong
Crystal Structure Of The V-Type Atp Synthase Subunit F From Archaeoglobus Fulgidus
To Be Published
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (2, 2)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:79
 aligned with VATF_ARCFU | O29102 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:79
                                    10        20        30        40        50        60        70         
            VATF_ARCFU    1 MKKLAVVGDPDFTIGFMLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIIKQEYLKKLPPVLRREIDEKVEPTFVSVG 79
               SCOP domains ---d2i4ra1 A:4-79 V-type ATP synthase subunit F, AtpF                           SCOP domains
               CATH domains 2i4rA00 A:-2-79 v-type atp synthase like domains                                CATH domains
               Pfam domains ------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeehhhhhhhhhhh....eee..hhhhhhhhhhhhhhh..eeeeeee.hhh...hhhhhh........eeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------- Transcript
                  2i4r A -2 SHmLAVVGDPDFTIGFmLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVImKQEYLKKLPPVLRREIDEKVEPTFVSVG 79
                              ||    10      | 20        30        40        50|       60        70         
                              ||           17-MSE                            51-MSE                        
                              0-MSE                                                                        
                               4

Chain B from PDB  Type:PROTEIN  Length:80
 aligned with VATF_ARCFU | O29102 from UniProtKB/Swiss-Prot  Length:101

    Alignment length:80
                             1                                                                              
                             |       9        19        29        39        49        59        69        79
            VATF_ARCFU    - -MKKLAVVGDPDFTIGFMLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVIIKQEYLKKLPPVLRREIDEKVEPTFVSVG 79
               SCOP domains d2i4rb_ B: V-type ATP synthase subunit F, AtpF                                   SCOP domains
               CATH domains 2i4rB00 B:-3-79 v-type atp synthase like domains                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeehhhhhhhhhhh....eee..hhhhhhhhhhhhhhh..eeeeeee..hhhhhhhhhhhhhhhh...eeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------- Transcript
                  2i4r B -3 HSHmLAVVGDPDFTIGFmLAGISDIYEVTSDEEIVKAVEDVLKRDDVGVVImKQEYLKKLPPVLRREIDEKVEPTFVSVG 79
                               ||    9       |19        29        39        49 |      59        69        79
                               0-MSE        17-MSE                            51-MSE                        
                                4

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (8, 8)

Asymmetric Unit(hide GO term definitions)

Chain A,B (VATF_ARCFU | O29102)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0046933	proton-transporting ATP synthase activity, rotational mechanism	Catalysis of the transfer of protons from one side of a membrane to the other according to the reaction: ADP + H2O + phosphate + H+(in) = ATP + H+(out), by a rotational mechanism.
biological process
	GO:0006754	ATP biosynthetic process	The chemical reactions and pathways resulting in the formation of ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0034220	ion transmembrane transport	A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0042777	plasma membrane ATP synthesis coupled proton transport	The transport of protons across the plasma membrane to generate an electrochemical gradient (proton-motive force) that powers ATP synthesis.
	GO:0015992	proton transport	The directed movement of protons (hydrogen ions) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
(no "Sites" information available for 2i4r)

	Cis Peptide Bonds
		Glu A:72 - Pro A:73	[ RasMol ]
		Glu B:72 - Pro B:73	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2i4r
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	VATF_ARCFU \| O29102
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.6.3.14
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description