Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A FAD BINDING PROTEIN FROM BACILLUS CEREUS, A PUTATIVE NAD(FAD)-UTILIZING DEHYDROGENASES
 
Authors :  G. Minasov, L. Shuvalova, I. I. Vorontsov, O. Kiryukhina, J. Abdullah, F. R. Collart, A. Joachimiak, W. F. Anderson, Midwest Center For Structural Genomics (Mcsg)
Date :  11 Aug 06  (Deposition) - 22 Aug 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.84
Chains :  Asym./Biol. Unit :  A
Keywords :  Crystal Structure, Structural Genomics, Nad(Fad)-Utilizing Dehydrogenases, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. Minasov, L. Shuvalova, I. I. Vorontsov, O. Kiryukhina, J. Abdullah, F. R. Collart, A. Joachimiak, W. F. Anderson
Crystal Structure Of A Fad Binding Protein From Bacillus Cereus, A Putative Nad(Fad)-Utilizing Dehydrogenases
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NAD(FAD)-UTILIZING DEHYDROGENASES
    Atcc: 14579
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PMCSG7
    Expression System Strain: BL21-DE3
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: BC_4706
    Mutation: YES
    Organism Scientific: BACILLUS CEREUS
    Organism Taxid: 1396
    Strain: DSM 31

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 2)

Asymmetric/Biological Unit (2, 2)
No.NameCountTypeFull Name
1CL1Ligand/IonCHLORIDE ION
2FAD1Ligand/IonFLAVIN-ADENINE DINUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE A:359 , THR A:396 , GLY A:397 , GLY A:398 , FAD A:501 , HOH A:512 , HOH A:849 , HOH A:856BINDING SITE FOR RESIDUE CL A 424
2AC2SOFTWAREGLY A:9 , GLY A:11 , PRO A:12 , SER A:13 , ASP A:32 , LYS A:33 , ARG A:39 , LYS A:40 , SER A:44 , GLY A:45 , ASN A:50 , PRO A:132 , VAL A:133 , ALA A:162 , VAL A:163 , GLY A:164 , VAL A:168 , THR A:171 , GLY A:172 , ASP A:176 , TRP A:180 , PHE A:359 , VAL A:360 , GLY A:387 , GLU A:388 , GLY A:398 , TYR A:399 , ASN A:400 , ILE A:401 , CL A:424 , HOH A:502 , HOH A:504 , HOH A:505 , HOH A:507 , HOH A:510 , HOH A:511 , HOH A:533BINDING SITE FOR RESIDUE FAD A 501

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2I0Z)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2I0Z)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2I0Z)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2I0Z)

(-) Exons   (0, 0)

(no "Exon" information available for 2I0Z)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:416
 aligned with Q816V9_BACCR | Q816V9 from UniProtKB/TrEMBL  Length:423

    Alignment length:420
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420
         Q816V9_BACCR     1 MHYDVIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNNEDIITFFENLGVKLKEEDPGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVILQTGEVLETNHVVIAVGGKSVPQTGSTGDGYAWAEKAGHTITELFPTEVPILSNEPFIRDRSLQGLALRDINLSVLNPKGKAIISHKMDMLFTHFGLSGPAALRCSQFVVKALKKFKTNTIQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNEIDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYNITSALVTGRIAGTTAGENAK 420
               SCOP domains d2i0za1 A:1-192,A:362-420 Flavoprotein BC4706                                                                                                                                                   d2i0za2 A:193-361 Flavoprotein B    C4706                                                                                                                                d2i0za1 A:1-192,A:362-420 Flavoprotein BC4706               SCOP domains
               CATH domains 2i0zA01 A:1-194,A:355-420  [code=3.50.50.60, no name defined]                                                                                                                                     ----------------------------------------------------------------------------------------------------------------------------------------------------------------2i0zA01 A:1-194,A:355-420  [code=3.50.50.60, no name defined]      CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....eeee..hhhhhhhhhhhhhh...eeee......hhhhhhhhhhh...ee..hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh...eee....eeee...hhhhhhhhhhhhhhhh..eee....eeeeeee..eeeeeee....eee...eee......hhhhh...hhhhhhhhh...eeeeee....ee..hhhhhh......eeeeeeeee..----.eeeeeeeeee...eeehhhhhhhhhhhhhhhhhhh...eeeeee.....hhhhhhhhhhhhhh.....hhhhhh....hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhheeeee.ee.hhhhh..eeeee.hhhh............eee.hhhh.......hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2i0z A   1 MHYDVIVIGGGPSGLMAAIGAAEEGANVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVKHIPGNGRFLYSAFSIFNNEDIITFFENLGVKLKEEDHGRMFPVSNKAQSVVDALLTRLKDLGVKIRTNTPVETIEYENGQTKAVILQTGEVLETNHVVIAVGGKSVPQTGSTGDGYAWAEKAGHTITELFPTEVPILSNEPFIRDRSLQGLALRDINLSVLN----AIISHKMDMLFTHFGLSGPAALRCSQFVVKALKKFKTNTIQMSIDALPEENSEQLFQRMLKQMKEDPKKGIKNVLKGYVPERYFLFLLEKNEIDGSEQAGQVSHEKIRALVKDFKEFTVNVNGTQSIEKAFVTGGGVSVKEINPKEMSSKFTNGLYFCGEVLDIHGYTGGYNITSALVTGRIAGTTAGENAK 420
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220   |   230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420
                                                                                                                                                                                                                                                         224  229
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)
(-)
Class: Multi-domain proteins (alpha and beta) (2421)

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2I0Z)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q816V9_BACCR | Q816V9)
molecular function
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    FAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2i0z)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2i0z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q816V9_BACCR | Q816V9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q816V9_BACCR | Q816V9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2I0Z)

(-) Related Entries Specified in the PDB File

2gqf 2GQF IS THE CRYSTAL STRUCTURE OF HYPOTHETICAL FLAVOPROTEIN HI0933 FROM HAEMOPHILUS INFLUENZAE DETERMINED AT 2.70 ANGSTROM RESOLUTION