Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF FMN-DEPENDENT AZOREDUCTASE FROM ENTEROCOCCUS FAECALIS
 
Authors :  Z. J. Liu, L. Chen, H. Chen, J. Rose, B. C. Wang, Southeast Collaborator Structural Genomics (Secsg)
Date :  17 Jul 06  (Deposition) - 12 Sep 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C,D  (1x)
Keywords :  Azoreductase, Enterococcus Faecalis, Structural Genomics, Psi, Protein Structure Initiative, Southeast Collaboratory For Structural Genomics, Secsg, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Z. J. Liu, H. Chen, L. Chen, N. Shah, J. P. Rose, B. C. Wang
Crystal Structure Of Fmn-Dependent Azoreductase From Enterococcus Faecalis At 2. 00 A Resolution
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - FMN-DEPENDENT NADH-AZOREDUCTASE
    Chains: A, B, C, D
    EC Number: 1.7.-.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: ROSETTA (DE3)
    Expression System Taxid: 562
    Gene: AZOR, AZOA
    Organism Scientific: ENTEROCOCCUS FAECALIS
    Organism Taxid: 1351

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): AB  
Biological Unit 2 (1x):   CD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 16)

Asymmetric Unit (2, 16)
No.NameCountTypeFull Name
1FMN4Ligand/IonFLAVIN MONONUCLEOTIDE
2MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (2, 8)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
2MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (2, 8)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE
2MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:10 , SER A:17 , ARG A:18 , SER A:19 , PRO A:103 , MSE A:104 , TRP A:105 , ASN A:106 , LEU A:107 , SER A:148 , GLY A:150 , GLY A:151 , TYR A:153 , ASP A:184 , HOH A:1210 , HOH A:1237 , HOH A:1245 , HOH A:1262 , ILE B:54BINDING SITE FOR RESIDUE FMN A 1200
2AC2SOFTWAREILE A:54 , HIS B:10 , SER B:17 , ARG B:18 , SER B:19 , PRO B:103 , MSE B:104 , TRP B:105 , ASN B:106 , LEU B:107 , SER B:148 , ASN B:149 , GLY B:150 , GLY B:151 , TYR B:153 , ASP B:184 , HOH B:1204 , HOH B:1217 , HOH B:1227 , HOH B:1252BINDING SITE FOR RESIDUE FMN B 1201
3AC3SOFTWAREHIS C:10 , SER C:17 , ARG C:18 , SER C:19 , PRO C:103 , MSE C:104 , TRP C:105 , ASN C:106 , LEU C:107 , SER C:148 , ASN C:149 , GLY C:150 , GLY C:151 , TYR C:153 , ASP C:184 , HOH C:1204 , HOH C:1219 , HOH C:1258 , HOH C:1297 , ILE D:54BINDING SITE FOR RESIDUE FMN C 1202
4AC4SOFTWAREHIS D:10 , SER D:17 , ARG D:18 , SER D:19 , PRO D:103 , MSE D:104 , TRP D:105 , ASN D:106 , LEU D:107 , SER D:148 , ASN D:149 , GLY D:150 , GLY D:151 , TYR D:153 , ASP D:184 , HOH D:1223 , HOH D:1271BINDING SITE FOR RESIDUE FMN D 1203

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2HPV)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2HPV)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2HPV)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2HPV)

(-) Exons   (0, 0)

(no "Exon" information available for 2HPV)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:207
 aligned with AZOR_ENTFA | Q831B2 from UniProtKB/Swiss-Prot  Length:208

    Alignment length:207
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
           AZOR_ENTFA     2 SKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEILDVYAPETNMPEIDEELLSAWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPMWNLNVPTRLKAWVDTINVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEGKDFASQYIKAILNFIGVDQVDGLFIEGIDHFPDRAEELLNTAMTKATEYGKTF 208
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2hpvA00 A:2-208  [code=3.40.50.360, no name defined]                                                                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee........hhhhhhhhhhhhhhhhhh...eeeeee..hhhhh....hhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee......hhhhhhhhhhhh.....eeee..eeee.....eeeeeeee.......hhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hpv A   2 SKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEILDVYAPETNmPEIDEELLSAWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPmWNLNVPTRLKAWVDTINVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEGKDFASQYIKAILNFIGVDQVDGLFIEGIDHFPDRAEELLNTAmTKATEYGKTF 208
                                    11        21        31        41        51        61        71        81        91       101  |    111       121       131       141       151       161       171       181       191      |201       
                                                                            51-MSE                                              104-MSE                                                                                       198-MSE      


Chain B from PDB  Type:PROTEIN  Length:207
 aligned with AZOR_ENTFA | Q831B2 from UniProtKB/Swiss-Prot  Length:208

    Alignment length:207
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
           AZOR_ENTFA     2 SKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEILDVYAPETNMPEIDEELLSAWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPMWNLNVPTRLKAWVDTINVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEGKDFASQYIKAILNFIGVDQVDGLFIEGIDHFPDRAEELLNTAMTKATEYGKTF 208
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2hpvB00 B:2-208  [code=3.40.50.360, no name defined]                                                                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee........hhhhhhhhhhhhhhhhhh...eeeeee..hhhhh....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee......hhhhhhhhhhhh.....ee......ee.....eeeeeeee.......hhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hpv B   2 SKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEILDVYAPETNmPEIDEELLSAWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPmWNLNVPTRLKAWVDTINVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEGKDFASQYIKAILNFIGVDQVDGLFIEGIDHFPDRAEELLNTAmTKATEYGKTF 208
                                    11        21        31        41        51        61        71        81        91       101  |    111       121       131       141       151       161       171       181       191      |201       
                                                                            51-MSE                                              104-MSE                                                                                       198-MSE      


Chain C from PDB  Type:PROTEIN  Length:207
 aligned with AZOR_ENTFA | Q831B2 from UniProtKB/Swiss-Prot  Length:208

    Alignment length:207
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
           AZOR_ENTFA     2 SKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEILDVYAPETNMPEIDEELLSAWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPMWNLNVPTRLKAWVDTINVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEGKDFASQYIKAILNFIGVDQVDGLFIEGIDHFPDRAEELLNTAMTKATEYGKTF 208
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2hpvC00 C:2-208  [code=3.40.50.360, no name defined]                                                                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee........hhhhhhhhhhhhhhhhhh...eeeeee..hhhhh....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee......hhhhhhhhhhhh.....ee......ee.....eeeeeeee.......hhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hpv C   2 SKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEILDVYAPETNmPEIDEELLSAWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPmWNLNVPTRLKAWVDTINVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEGKDFASQYIKAILNFIGVDQVDGLFIEGIDHFPDRAEELLNTAmTKATEYGKTF 208
                                    11        21        31        41        51        61        71        81        91       101  |    111       121       131       141       151       161       171       181       191      |201       
                                                                            51-MSE                                              104-MSE                                                                                       198-MSE      


Chain D from PDB  Type:PROTEIN  Length:207
 aligned with AZOR_ENTFA | Q831B2 from UniProtKB/Swiss-Prot  Length:208

    Alignment length:207
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       
           AZOR_ENTFA     2 SKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEILDVYAPETNMPEIDEELLSAWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPMWNLNVPTRLKAWVDTINVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEGKDFASQYIKAILNFIGVDQVDGLFIEGIDHFPDRAEELLNTAMTKATEYGKTF 208
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2hpvD00 D:2-208  [code=3.40.50.360, no name defined]                                                                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee........hhhhhhhhhhhhhhhhhh...eeeeee..hhhhh....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee......hhhhhhhhhhhh.....eeee..eeee.....eeeeeeee.......hhhhhhhhhhhhhh...eeeeeeee....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hpv D   2 SKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEILDVYAPETNmPEIDEELLSAWGALRAGAAFETLSENQQQKVARFNELTDQFLSADKVVIANPmWNLNVPTRLKAWVDTINVAGKTFQYTAEGPKPLTSGKKALHIQSNGGFYEGKDFASQYIKAILNFIGVDQVDGLFIEGIDHFPDRAEELLNTAmTKATEYGKTF 208
                                    11        21        31        41        51        61        71        81        91       101  |    111       121       131       141       151       161       171       181       191      |201       
                                                                            51-MSE                                              104-MSE                                                                                       198-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2HPV)

(-) CATH Domains  (1, 4)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2HPV)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (AZOR_ENTFA | Q831B2)
molecular function
    GO:0010181    FMN binding    Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0008752    FMN reductase activity    Catalysis of the reaction: FMNH2 + NAD(P)+ = FMN + NAD(P)H + H+.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016652    oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces NAD+ or NADP.
    GO:0016661    oxidoreductase activity, acting on other nitrogenous compounds as donors    Catalysis of an oxidation-reduction (redox) reaction in which a nitrogenous group, excluding NH and NH2 groups, acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2hpv)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2hpv
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AZOR_ENTFA | Q831B2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.7.-.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AZOR_ENTFA | Q831B2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2HPV)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2HPV)