|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2HPU) |
Sites (0, 0)| (no "Site" information available for 2HPU) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2HPU) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2HPU) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2HPU) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2HPU) |
Exons (0, 0)| (no "Exon" information available for 2HPU) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:126 aligned with NOSL_ACHCY | O68481 from UniProtKB/Swiss-Prot Length:193 Alignment length:126 62 72 82 92 102 112 122 132 142 152 162 172 NOSL_ACHCY 53 KAQIFLEGSPAPLFFSQVRDAIAYARGPEQIAPILVIYVNDMGAAGATWDQPGDGNWIAADKAFYVVGSARRGGMGAPEAVPFSSRDEAAAFVLAEGGQVLALADITDAMVLTPVETGSEPRADDE 178 SCOP domains d2hpua1 A:35-160 NosL SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------ Transcript 2hpu A 35 KAQIFLEGSPAPLFFSQVRDAIAYARGPEQIAPILVIYVNDMGAAGATWDQPGDGNWIAADKAFYVVGSARRGGMGAPEAVPFSSRDEAAAFVLAEGGQVLALADITDAMVLTPVETGSEPRADDE 160 44 54 64 74 84 94 104 114 124 134 144 154
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2HPU) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2HPU) |
Gene Ontology (0, 0)|
NMR Structure(hide GO term definitions)
(no "Gene Ontology" information available for 2HPU)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|