2HMW - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Title :   SQUARE-SHAPED OCTAMERIC RING STRUCTURE OF AN RCK DOMAIN WITH ATP BOUND

Authors :   R. A. Albright, J. H. Morais-Cabral

Date :   11 Jul 06 (Deposition) - 26 Sep 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (4x)

Keywords :   Rck, Ktn, Ktr, Ktra, Ktrab, Membrane Protein, Ion Transporter, Symporter, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. A. Albright, J. L. Ibar, C. U. Kim, S. M. Gruner, J. H. Morais-Cabral
The Rck Domain Of The Ktrab K(+) Transporter: Multiple Conformations Of An Octameric Ring.
Cell(Cambridge, Mass. ) V. 126 1147 2006
PubMed-ID: 16990138 | Reference-DOI: 10.1016/J.CELL.2006.08.028
(for further references see the PDB file header)

Molecule 1 - YUAA PROTEIN
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET15B
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	RCK CORE DOMAIN (KTN), RESIDUES 1-144
	Gene	:	YUAA
	Mutation	:	YES
	Organism Scientific	:	BACILLUS SUBTILIS
	Organism Taxid	:	1423

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (4x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 2)

No.	Name	Count	Type	Full Name
1	ATP	2	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE

Biological Unit 1 (1, 8)

No.	Name	Count	Type	Full Name
1	ATP	8	Ligand/Ion	ADENOSINE-5'-TRIPHOSPHATE

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:13 , GLY A:15 , ARG A:16 , ASP A:36 , ILE A:37 , ASN A:38 , LYS A:41 , ALA A:55 , ASN A:56 , ALA A:57 , THR A:58 , ILE A:78 , GLY A:79 , ALA A:80 , ALA A:84	BINDING SITE FOR RESIDUE ATP A 601
2	AC2	SOFTWARE	GLU A:125 , LEU B:14 , ARG B:16 , ASP B:36 , ILE B:37 , ASN B:38 , LYS B:41 , ALA B:55 , ASN B:56 , ALA B:57 , THR B:58 , ILE B:78 , GLY B:79 , ALA B:80	BINDING SITE FOR RESIDUE ATP B 602

(no "SS Bond" information available for 2HMW)

(no "Cis Peptide Bond" information available for 2HMW)

(no "SAP(SNP)/Variant" information available for 2HMW)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RCK_N	PS51201	RCK N-terminal domain profile.	KTRA_BACSU	8-129	2	A:8-129 B:8-129
2	RCK_C	PS51202	RCK C-terminal domain profile.	KTRA_BACSU	139-222	2	A:139-140 B:139-144

Biological Unit 1 (2, 16)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	RCK_N	PS51201	RCK N-terminal domain profile.	KTRA_BACSU	8-129	8	A:8-129 B:8-129
2	RCK_C	PS51202	RCK C-terminal domain profile.	KTRA_BACSU	139-222	8	A:139-140 B:139-144

(no "Exon" information available for 2HMW)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:135
 aligned with KTRA_BACSU | O32080 from UniProtKB/Swiss-Prot  Length:222

    Alignment length:135
                                    15        25        35        45        55        65        75        85        95       105       115       125       135     
           KTRA_BACSU     6 NKQFAVIGLGRFGGSICKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDEN 140
               SCOP domains d2hmwa_ A: Ktn bsu222                                                                                                                   SCOP domains
               CATH domains 2hmwA00 A:6-140 NAD(P)-binding Rossmann-like Domain                                                                                     CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeee..hhhhhhhhhhhhhh....eee..hhhhhhhhh....eee.......hhhhhhhhhhh.eeee....hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhh..eeehhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --RCK_N  PDB: A:8-129 UniProt: 8-129                                                                                        ---------RC PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hmw A   6 NKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDEN 140
                                    15        25        35        45        55        65        75        85        95       105       115       125       135

Chain B from PDB  Type:PROTEIN  Length:137
 aligned with KTRA_BACSU | O32080 from UniProtKB/Swiss-Prot  Length:222

    Alignment length:137
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       
           KTRA_BACSU     8 QFAVIGLGRFGGSICKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY 144
               SCOP domains d2hmwb_ B: Ktn bsu222                                                                                                                     SCOP domains
               CATH domains 2hmwB00 B:8-144 NAD(P)-binding Rossmann-like Domain                                                                                       CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeee..hhhhhhhhhhhhhh...eeee..hhhhhhh......eee.......hhhhhhhhhhh.eeee....hhhhhhhhhhhhhhh...eeeee..hhhhhhhhhhhh..eeehhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE RCK_N  PDB: B:8-129 UniProt: 8-129                                                                                        ---------RCK_C  PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2hmw B   8 QFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNY 144
                                    17        27        37        47        57        67        77        87        97       107       117       127       137

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: NAD(P)-binding Rossmann-fold domains (1604)

Superfamily: NAD(P)-binding Rossmann-fold domains (1604)

Family: Potassium channel NAD-binding domain (19)

Protein domain: Ktn bsu222 (6)

Bacillus subtilis [TaxId: 1423] (6)

1a	d2hmwa_	A:
1b	d2hmwb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Rossmann fold (7312)

Homologous Superfamily: NAD(P)-binding Rossmann-like Domain (1244)

Bacillus subtilis. Organism_taxid: 1423. (9)

1a	2hmwB00	B:8-144
1b	2hmwA00	A:6-140

(no "Pfam Domain" information available for 2HMW)

Asymmetric Unit(hide GO term definitions)

Chain A,B (KTRA_BACSU | O32080)

molecular function
	GO:0008324	cation transmembrane transporter activity	Enables the transfer of cation from one side of the membrane to the other.
biological process
	GO:0098655	cation transmembrane transport	A process in which a cation is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0006811	ion transport	The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006813	potassium ion transport	The directed movement of potassium ions (K+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ATP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2hmw)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2hmw
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	KTRA_BACSU \| O32080
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	KTRA_BACSU \| O32080
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	KTRA_BACSU \| O32080	:	1lsu 2hms 2hmt 2hmu 2hmv 4j7c 4j90 4j91 5but

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (7, 7)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File