|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 3)
NMR Structure (1, 3)
|
Sites (3, 3)
NMR Structure (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2HGH) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2HGH) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2HGH) |
PROSITE Motifs (1, 2)
NMR Structure (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2HGH) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:87 aligned with TF3A_XENLA | P03001 from UniProtKB/Swiss-Prot Length:366 Alignment length:87 135 145 155 165 175 185 195 205 TF3A_XENLA 126 VYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQD 212 SCOP domains d2hgha1 A:104-131 d2hgha2 A:132-160 d2hgha3 A:161-190 SCOP domains CATH domains 2hghA01 A:104-132 2hghA02 A:133-161 2hghA03 A:162-190 CATH domains Pfam domains --------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---ZINC_FINGER_C2H2_1 -------ZINC_FINGER_C2H2_1 ------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------- Transcript 2hgh A 104 MYVCHFENCGKAFKKHNQLKVHQFSHTQQLPYECPHEGCDKRFSLPSRLKRHEKVHAGYPCKKDDSCSFVGKTWTLYLKHVAECHQD 190 113 123 133 143 153 163 173 183
Chain B from PDB Type:RNA Length:55
2hgh B 1 GGGCCAUACCUCUUGGGCCUGGUUAGUACCUCUUCGGUGGGAAUACCAGGUGCCC 55
10 20 30 40 50
|
||||||||||||||||||||
SCOP Domains (1, 3)
NMR Structure
|
CATH Domains (1, 3)| NMR Structure |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2HGH) |
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (TF3A_XENLA | P03001)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|