|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 5)
Asymmetric Unit (4, 5)
|
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2HCM) |
Cis Peptide Bonds (1, 1)
Asymmetric Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2HCM) |
PROSITE Motifs (2, 2)
Asymmetric Unit (2, 2)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2HCM) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:159 aligned with DUS28_MOUSE | Q8BTR5 from UniProtKB/Swiss-Prot Length:163 Alignment length:159 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 149 DUS28_MOUSE - -MGTSEAAPPPFARVAPALFIGNARAAGATELLVRAGITLCVNVSRQQPGPRAPGVAELRVPVFDDPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVCTAYLMRHRGHSLDRAFQMVKSARPVAEPNLGFWAQLQKYEQTLQAQAILPRE 158 SCOP domains d2hcma_ A: automated matches SCOP domains CATH domains ----------2hcmA01 A:10-158 Protein tyrosine phosphatase superfamily CATH domains Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (1) ----------TYR_PHOSPHATASE_DUAL PDB: A:10-150 UniProt: 10-150 -------- PROSITE (1) PROSITE (2) --------------------------------------------------------------------TYR_PHOSPHATASE_2 PDB: A:68-130 UniProt: 68-130 ---------------------------- PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2hcm A 0 SLGTSEAAPPPFARVAPALFIGNARAAGATELLVRAGITLCVNVSRQQPGPRAPGVAELRVPVFDDPAEDLLTHLEPTCAAMEAAVRDGGSCLVYCKNGRSRSAAVCTAYLMRHRGHSLDRAFQMVKSARPVAEPNLGFWAQLQKYEQTLQAQAILPRE 158 9 19 29 39 49 59 69 79 89 99 109 119 129 139 149
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2HCM) |
Gene Ontology (8, 8)|
Asymmetric Unit(hide GO term definitions) Chain A (DUS28_MOUSE | Q8BTR5)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|