Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROTEIN SP0239 FROM STREPTOCOCCUS PNEUMONIAE
 
Authors :  C. Chang, C. Hatzos, J. Abdullah, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  12 Jun 06  (Deposition) - 08 Aug 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.70
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A,B  (2x)
Keywords :  Streptococcus Pneumoniae, Structural Genomics, Psi-2, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Chang, C. Hatzos, J. Abdullah, A. Joachimiak
Crystal Structure Of Protein Sp0239 From Streptococcus Pneumoniae
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - UPF0210 PROTEIN SP0239
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PMCSG
    Expression System Strain: BL21(DE3) DERIVATIVES
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: STREPTOCOCCUS PNEUMONIAE
    Organism Taxid: 1313

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): AB
Biological Unit 2 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 34)

Asymmetric Unit (1, 34)
No.NameCountTypeFull Name
1MSE34Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 34)
No.NameCountTypeFull Name
1MSE34Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 68)
No.NameCountTypeFull Name
1MSE68Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2HA9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2HA9)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Ala A:438 -Pro A:439
2Ala B:438 -Pro B:439

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2HA9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2HA9)

(-) Exons   (0, 0)

(no "Exon" information available for 2HA9)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:414
 aligned with Y239_STRPN | Q97ST4 from UniProtKB/Swiss-Prot  Length:445

    Alignment length:441
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                                       
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439 
           Y239_STRPN     - -MDIRQVTETIAMIEEQNFDIRTITMGISLLDCIDPDINRAAEKIYQKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVKRALEKVRGQSFDVVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPAVGDSVARVLEEMGLETVGTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAVQNGSLNLEKLEAMTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKTTAVRIIPKGKEGDMIEFGGLLGTAPVMKVNGASSVDFISRGGQIPAPI 440
               SCOP domains -d2ha9a1 A:1-440 Uncharacterized protein SP0239                                                                                                                                                                                                                                                                                                                                                                                                           SCOP domains
               CATH domains 2ha9A00 A:0-440  [code=3.20.70.20, no name defined]                                                                                                                                                                                                                                                                                                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh...eeeeeeee.hhhhh..hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..eeeeeeee.hhhhhhhh.....hhhhhhhhhhhhhhhh..eeeeeeee.......hhhhhhhhhhhhhhh...eeeeee.ee...eeehhhhhhhhhhhhhhhh...hhhh.eeeee..........-.........eeeeeee.hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeee.......----.hhhhhhhhh........hhhhhhhhhhhhhhhhhhh...--------------hhhhhhhhhh...hhhhhhhhh....---.eeee....hhhhhhhhhhhhhhhhhhhh..eeeeeee..........-----...........hhhhhhh..ee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ha9 A   0 AmDIRQVTETIAmIEEQNFDIRTITmGISLLDCIDPDINRAAEKIYQKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINmTAVADmGRIIKETANLSDmGVAKLVVFANAVEDNPFmA-AFHGVGEADVIINVGVSGPGVVKRALEKVRGQSFDVVAETVKKTAFKITRIGQLVGQmASERLGVEFGIVDLSLAPT----DSVARVLEEmGLETVGTHGTTAALALLNDQVKKGGVmACN--------------DEGmIAAVQNGSLNLEKLEAmTAICS---DmIAIPEDTPAETIAAmIADEAAIGVINmKTTAVRIIPKGKEGDmIEF-----TAPVmKVNGASSVDFISRGGQIPAPI 440
                             |       9  |     19     |  29        39        49        59        69        79        89        99       109       119       129       139       149       159    |  169       179       189     ||199       209       219       229       239       249     | 259       269    |  279       289       299       309     |  |-         -   |  |339       349   |    |-  ||   369       379       389|      399      |409     | 419       429       439 
                             |         12-MSE       25-MSE                                                                                                                              158-MSE |          177-MSE           195-MSE                                                     255-MSE            274  279      288-MSE                    315-MSE           333  |              353-MSE8 362|            378-MSE     390-MSE         406-MSE  415   |                     
                             1-MSE                                                                                                                                                            164-MSE                         196 |                                                                                                                     318               336-MSE                    363-MSE                                       409       419-MSE                 
                                                                                                                                                                                                                                198                                                                                                                                                                                                                                                  


Chain B from PDB  Type:PROTEIN  Length:415
 aligned with Y239_STRPN | Q97ST4 from UniProtKB/Swiss-Prot  Length:445

    Alignment length:441
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                                       
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439 
           Y239_STRPN     - -MDIRQVTETIAMIEEQNFDIRTITMGISLLDCIDPDINRAAEKIYQKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINMTAVADMGRIIKETANLSDMGVAKLVVFANAVEDNPFMAGAFHGVGEADVIINVGVSGPGVVKRALEKVRGQSFDVVAETVKKTAFKITRIGQLVGQMASERLGVEFGIVDLSLAPTPAVGDSVARVLEEMGLETVGTHGTTAALALLNDQVKKGGVMACNQVGGLSGAFIPVSEDEGMIAAVQNGSLNLEKLEAMTAICSVGLDMIAIPEDTPAETIAAMIADEAAIGVINMKTTAVRIIPKGKEGDMIEFGGLLGTAPVMKVNGASSVDFISRGGQIPAPI 440
               SCOP domains d2ha9b_ B: automated matches                                                                                                                                                                                                                                                                                                                                                                                                                              SCOP domains
               CATH domains 2ha9B00 B:0-440  [code=3.20.70.20, no name defined]                                                                                                                                                                                                                                                                                                                                                                                                       CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh...eeeeeeee.hhhhh..hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhh..eeeeeeee.hhhhhhhh.....hhhhhhhhhhhhhhhh..eeeeeeee.......hhhhhhhhhhhhhhh...eeeeeeeee...eeehhhhhhhhhhhhhhhhh...hhh.eeeee...-...-............eeeeeee.hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.....---....hhhhhhhh........hhhhhhhhhhhhhhhhhhhh...------------.hhhhhhhhhh...hhhhhhhhhh...---..eee....hhhhhhhhhhhhhhhhhhh...eee.eee..........------..........hhhhhhh..ee.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ha9 B   0 AmDIRQVTETIAmIEEQNFDIRTITmGISLLDCIDPDINRAAEKIYQKITTKAANLVAVGDEIAAELGIPIVNKRVSVTPISLIGAATDATDYVVLAKALDKAAKEIGVDFIGGFSALVQKGYQKGDEILINSIPRALAETDKVCSSVNIGSTKSGINmTAVADmGRIIKETANLSDmGVAKLVVFANAV-DNP-mAGAFHGVGEADVIINVGVSGPGVVKRALEKVRGQSFDVVAETVKKTAFKITRIGQLVGQmASERLGVEFGIVDLSLAP---VGDSVARVLEEmGLETVGTHGTTAALALLNDQVKKGGVmACNQ------------EDEGmIAAVQNGSLNLEKLEAmTAICS---DmIAIPEDTPAETIAAmIADEAAIGVINmKTTAVRIIPKGKEGDmIEF------APVmKVNGASSVDFISRGGQIPAPI 440
                             |       9  |     19     |  29        39        49        59        69        79        89        99       109       119       129       139       149       159    |  169       179       189 | | | 199       209       219       229       239       249     | 259       269   |   279       289       299       309     | 319         -  |   |339       349   |    |-  ||   369       379       389|      399      |409      |419       429       439 
                             1-MSE     12-MSE       25-MSE                                                                                                                              158-MSE |          177-MSE     189 | | |                                                         255-MSE           273 277        288-MSE                    315-MSE          332   |              353-MSE8 362|            378-MSE     390-MSE         406-MSE   416  |                     
                                                                                                                                                                                              164-MSE                    191 | |                                                                                                                                          336-MSE                    363-MSE                                       409       419-MSE                 
                                                                                                                                                                                                                           193 |                                                                                                                                                                                                                                                     
                                                                                                                                                                                                                             195-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2HA9)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2HA9)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2ha9)
 
  Cis Peptide Bonds
    Ala A:438 - Pro A:439   [ RasMol ]  
    Ala B:438 - Pro B:439   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ha9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Y239_STRPN | Q97ST4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Y239_STRPN | Q97ST4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2HA9)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2HA9)