Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  HEPATOCYTE NUCLEAR FACTOR 1B BOUND TO DNA: MODY5 GENE PRODUCT
 
Authors :  P. Lu, G. B. Rha, Y. I. Chi
Date :  07 Jun 06  (Deposition) - 19 Jun 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.20
Chains :  Asym./Biol. Unit :  A,B,E,F
Keywords :  Trasncription Factor, Pou, Homeo, Protein-Dna, Human Disease, Transcription Activator/Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. Lu, G. B. Rha, Y. I. Chi
Structural Basis Of Disease-Causing Mutations In Hepatocyte Nuclear Factor 1Beta.
Biochemistry V. 46 12071 2007
PubMed-ID: 17924661  |  Reference-DOI: 10.1021/BI7010527
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HEPATOCYTE NUCLEAR FACTOR 1-BETA
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET41A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Fragment: DNA BINDING DOMAIN (RESIDUES 91-310)
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: HNF-1BETA, HNF-1B, VARIANT HEPATIC NUCLEAR FACTOR 1, VHNF1, HOMEOPROTEIN LFB3, TRANSCRIPTION FACTOR 2, TCF-2
 
Molecule 2 - 5'- D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP *G)-3'
    Chains: E
    Engineered: YES
    Synthetic: YES
 
Molecule 3 - 5'- D(*GP*CP*TP*GP*GP*TP*GP*AP*AP*TP*TP*AP*TP*TP*AP*AP*CP*CP*AP *A)-3'
    Chains: F
    Engineered: YES
    Synthetic: YES

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2H8R)

(-) Sites  (0, 0)

(no "Site" information available for 2H8R)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2H8R)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2H8R)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (19, 38)

Asymmetric/Biological Unit (19, 38)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
01UniProtVAR_046015V110GHNF1B_HUMANDisease (RCAD)  ---A/BV110G
02UniProtVAR_046016R112PHNF1B_HUMANDisease (RCAD)  ---A/BR112P
03UniProtVAR_046017Q136EHNF1B_HUMANDisease (RCAD)  ---A/BQ136E
04UniProtVAR_046018S148LHNF1B_HUMANDisease (RCAD)  ---A/BS148L
05UniProtVAR_046019S148WHNF1B_HUMANDisease (RCAD)121918674A/BS148W
06UniProtVAR_046020S151PHNF1B_HUMANDisease (RCAD)  ---A/BS151P
07UniProtVAR_046021H153NHNF1B_HUMANDisease (RCAD)  ---A/BH153N
08UniProtVAR_046022K156EHNF1B_HUMANDisease (RCAD)  ---A/BK156E
09UniProtVAR_046023K164QHNF1B_HUMANDisease (RCAD)  ---A/BK164Q
10UniProtVAR_046024R165HHNF1B_HUMANDisease (RCAD)121918675A/BR165H
11UniProtVAR_046025R235QHNF1B_HUMANDisease (RCAD)  ---A/BR235Q
12UniProtVAR_046026A241THNF1B_HUMANDisease (RCAD)761415487A/BA241T
13UniProtVAR_046027E260DHNF1B_HUMANDisease (RCAD)536638039A/BE260D
14UniProtVAR_046028R276GHNF1B_HUMANDisease (RCAD)  ---A/BR276G
15UniProtVAR_046029R276QHNF1B_HUMANDisease (RCAD)  ---A/BR276Q
16UniProtVAR_046030G285DHNF1B_HUMANDisease (RCAD)  ---A/BG285D
17UniProtVAR_046031R295CHNF1B_HUMANDisease (RCAD)  ---A/BR295C
18UniProtVAR_046032R295HHNF1B_HUMANDisease (RCAD)  ---A/BR295H
19UniProtVAR_046033R295PHNF1B_HUMANDisease (RCAD)  ---A/BR295P
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 4)

Asymmetric/Biological Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HOMEOBOX_2PS50071 'Homeobox' domain profile.HNF1B_HUMAN229-310
 		  2A:231-308
B:231-310
2HOMEOBOX_1PS00027 'Homeobox' domain signature.HNF1B_HUMAN285-308
 		  2A:285-308
B:285-308

(-) Exons   (0, 0)

(no "Exon" information available for 2H8R)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:176
 aligned with HNF1B_HUMAN | P35680 from UniProtKB/Swiss-Prot  Length:557

    Alignment length:219
                                    99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299         
          HNF1B_HUMAN    90 PILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEA 308
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2h8rA01 A:90-232 lambda repressor-like DNA-binding domains                                                                                     --2h8rA02 A:235-308 Homeodomain-like                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh.hhhhhhhhhh.hhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.....-------------------------------------------........hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.....hhhhhh....hhhhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) --------------------G-P-----------------------E-----------L--P-N--E-------QH---------------------------------------------------------------------Q-----T------------------D---------------G--------D---------C------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------W-------------------------------------------------------------------------------------------------------------------------------Q------------------H------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P------------- SAPs(SNPs) (3)
                PROSITE (1) -------------------------------------------------------------------------------------------------------------------------------------------HOMEOBOX_2  PDB: A:231-308 UniProt: 229-310                                      PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HOMEOBOX_1               PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2h8r A  90 SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTV-------------------------------------------MRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEA 308
                                    99       109       119       129       139       149       159       169       179       | -         -         -         -         - |     239       249       259       269       279       289       299         
                                                                                                                           187                                         231                                                                             


Chain B from PDB  Type:PROTEIN  Length:176
 aligned with HNF1B_HUMAN | P35680 from UniProtKB/Swiss-Prot  Length:557

    Alignment length:221
                                    99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309 
          HNF1B_HUMAN    90 PILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR 310
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2h8rB01 B:90-232 lambda repressor-like DNA-binding domains                                                                                     --2h8rB02 B:235-310 Homeodomain-like                                           CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhh.hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhh...---------------------------------------------........hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh.hhhhh..hhhhh.hhhhhhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) --------------------G-P-----------------------E-----------L--P-N--E-------QH---------------------------------------------------------------------Q-----T------------------D---------------G--------D---------C--------------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------------------------------------------------------W-------------------------------------------------------------------------------------------------------------------------------Q------------------H--------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------P--------------- SAPs(SNPs) (3)
                PROSITE (1) -------------------------------------------------------------------------------------------------------------------------------------------HOMEOBOX_2  PDB: B:231-310 UniProt: 229-310                                        PROSITE (1)
                PROSITE (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HOMEOBOX_1              -- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2h8r B  90 SILKELQALNTEEAAEQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREILRQFNQ---------------------------------------------MRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFR 310
                                    99       109       119       129       139       149       159       169       179     |   -         -         -         -         - |     239       249       259       269       279       289       299       309 
                                                                                                                         185                                           231                                                                               


Chain E from PDB  Type:DNA  Length:20
                                                    
                 2h8r E   1 CTTGGTTAATAATTCACCAG  20
                                    10        20


Chain F from PDB  Type:DNA  Length:20
                                                    
                 2h8r F   2 GCTGGTGAATTATTAACCAA  21
                                    11        21
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2H8R)

(-) CATH Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2H8R)

(-) Gene Ontology  (60, 60)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (HNF1B_HUMAN | P35680)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0001159    core promoter proximal region DNA binding    Interacting selectively and non-covalently with a region of DNA that is in cis with and relatively close to the core promoter. The transcribed region might be described as a gene, cistron, or operon.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0032403    protein complex binding    Interacting selectively and non-covalently with any protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0043565    sequence-specific DNA binding    Interacting selectively and non-covalently with DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
    GO:0003705    transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding    Interacting selectively and non-covalently with a sequence of DNA that is in a distal enhancer region for RNA polymerase II (RNAP II) in order to modulate transcription by RNAP II.
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
    GO:0044212    transcription regulatory region DNA binding    Interacting selectively and non-covalently with a DNA region that regulates the transcription of a region of DNA, which may be a gene, cistron, or operon. Binding may occur as a sequence specific interaction or as an interaction observed only once a factor has been recruited to the DNA by other factors.
biological process
    GO:0007219    Notch signaling pathway    A series of molecular signals initiated by the binding of an extracellular ligand to the receptor Notch on the surface of a target cell, and ending with regulation of a downstream cellular process, e.g. transcription.
    GO:0009952    anterior/posterior pattern specification    The regionalization process in which specific areas of cell differentiation are determined along the anterior-posterior axis. The anterior-posterior axis is defined by a line that runs from the head or mouth of an organism to the tail or opposite end of the organism.
    GO:0048754    branching morphogenesis of an epithelial tube    The process in which the anatomical structures of branches in an epithelial tube are generated and organized. A tube is a long hollow cylinder.
    GO:0032922    circadian regulation of gene expression    Any process that modulates the frequency, rate or extent of gene expression such that an expression pattern recurs with a regularity of approximately 24 hours.
    GO:0048557    embryonic digestive tract morphogenesis    The process in which the anatomical structures of the digestive tract are generated and organized during embryonic development. The digestive tract is the anatomical structure through which food passes and is processed.
    GO:0048598    embryonic morphogenesis    The process in which anatomical structures are generated and organized during the embryonic phase. The embryonic phase begins with zygote formation. The end of the embryonic phase is organism-specific. For example, it would be at birth for mammals, larval hatching for insects and seed dormancy in plants.
    GO:0031018    endocrine pancreas development    The process whose specific outcome is the progression of the endocrine pancreas over time, from its formation to the mature structure. The endocrine pancreas is made up of islet cells that produce insulin, glucagon and somatostatin.
    GO:0007492    endoderm development    The process whose specific outcome is the progression of the endoderm over time, from its formation to the mature structure. The endoderm is the innermost germ layer that develops into the gastrointestinal tract, the lungs and associated tissues.
    GO:0001714    endodermal cell fate specification    The cell fate determination process that results in a cell becoming capable of differentiating autonomously into an endoderm cell in an environment that is neutral with respect to the developmental pathway; upon specification, the cell fate can be reversed.
    GO:0050673    epithelial cell proliferation    The multiplication or reproduction of epithelial cells, resulting in the expansion of a cell population. Epithelial cells make up the epithelium, the covering of internal and external surfaces of the body, including the lining of vessels and other small cavities. It consists of cells joined by small amounts of cementing substances.
    GO:0060429    epithelium development    The process whose specific outcome is the progression of an epithelium over time, from its formation to the mature structure. An epithelium is a tissue that covers the internal or external surfaces of an anatomical structure.
    GO:0048806    genitalia development    The process whose specific outcome is the progression of the genitalia over time, from its formation to the mature structure.
    GO:0061017    hepatoblast differentiation    The process in which a relatively unspecialized cell acquires specialized features of a hepatoblast. A hepatoblast is a cell that retains the ability to divide and proliferate throughout life to provide progenitor cells that can differentiate into hepatocytes and cholangiocytes.
    GO:0070365    hepatocyte differentiation    The process in which a relatively unspecialized cell acquires the specialized features of a hepatocyte. A hepatocyte is specialized epithelial cell that is organized into interconnected plates called lobules, and is the main structural component of the liver.
    GO:0030902    hindbrain development    The process whose specific outcome is the progression of the hindbrain over time, from its formation to the mature structure. The hindbrain is the posterior of the three primary divisions of the developing chordate brain, or the corresponding part of the adult brain (in vertebrates, includes the cerebellum, pons, and medulla oblongata and controls the autonomic functions and equilibrium).
    GO:0001826    inner cell mass cell differentiation    The process in which a relatively unspecialized cell acquires specialized features of an inner cell mass cell.
    GO:0030073    insulin secretion    The regulated release of proinsulin from secretory granules (B granules) in the B cells of the pancreas; accompanied by cleavage of proinsulin to form mature insulin.
    GO:0001822    kidney development    The process whose specific outcome is the progression of the kidney over time, from its formation to the mature structure. The kidney is an organ that filters the blood and/or excretes the end products of body metabolism in the form of urine.
    GO:0060993    kidney morphogenesis    Morphogenesis of a kidney. A kidney is an organ that filters the blood and excretes the end products of body metabolism in the form of urine.
    GO:0001889    liver development    The process whose specific outcome is the progression of the liver over time, from its formation to the mature structure. The liver is an exocrine gland which secretes bile and functions in metabolism of protein and carbohydrate and fat, synthesizes substances involved in the clotting of the blood, synthesizes vitamin A, detoxifies poisonous substances, stores glycogen, and breaks down worn-out erythrocytes.
    GO:0072177    mesonephric duct development    The process whose specific outcome is the progression of a mesonephric duct over time, from its initial formation to a mature structure. A mesonephric duct is a tube drains the mesonephros.
    GO:0072181    mesonephric duct formation    The developmental process pertaining to the initial formation of a mesonephric duct. A mesonephric duct is a tube that drains the mesonephros.
    GO:0072164    mesonephric tubule development    The progression of a mesonephric tubule over time, from its initial formation to the mature structure. A mesonephric tubule is an epithelial tube that is part of the mesonephros.
    GO:0043066    negative regulation of apoptotic process    Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
    GO:0061296    negative regulation of mesenchymal cell apoptotic process involved in mesonephric nephron morphogenesis    Any process that reduces the occurrence or rate of mesenchymal stem cell death by apoptotic process that contributes to the shaping of the nephron in the mesonephros.
    GO:1900212    negative regulation of mesenchymal cell apoptotic process involved in metanephros development    Any process that stops, prevents or reduces the frequency, rate or extent of mesenchymal cell apoptotic process involved in metanephros development.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0072176    nephric duct development    The process whose specific outcome is the progression of a nephric duct over time, from its initial formation to a mature structure. A nephric duct is a tube that drains a primitive kidney.
    GO:0072179    nephric duct formation    The developmental process pertaining to the initial formation of a nephric duct. A nephric duct is a tube that drains a primitive kidney.
    GO:0010628    positive regulation of gene expression    Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
    GO:0045944    positive regulation of transcription from RNA polymerase II promoter    Any process that activates or increases the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0060261    positive regulation of transcription initiation from RNA polymerase II promoter    Any process that increases the rate, frequency or extent of a process involved in starting transcription from an RNA polymerase II promoter.
    GO:0045893    positive regulation of transcription, DNA-templated    Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0039020    pronephric nephron tubule development    The process whose specific outcome is the progression of a pronephric nephron tubule over time, from its formation to the mature structure. The pronephric nephron tubule is an epithelial tube that is part of the pronephric nephron and connects the filtration unit (glomerulus or glomus) of the pronephros to the pronephric duct.
    GO:0048793    pronephros development    The process whose specific outcome is the progression of the pronephros over time, from its formation to the mature structure. In mammals, the pronephros is the first of the three embryonic kidneys to be established and exists only transiently. In lower vertebrates such as fish and amphibia, the pronephros is the fully functional embryonic kidney and is indispensable for larval life.
    GO:0065004    protein-DNA complex assembly    The aggregation, arrangement and bonding together of proteins and DNA molecules to form a protein-DNA complex.
    GO:0030111    regulation of Wnt signaling pathway    Any process that modulates the frequency, rate or extent of the activity of the Wnt signal transduction pathway.
    GO:0072095    regulation of branch elongation involved in ureteric bud branching    Any process that modulates the frequency, rate or extent of branch elongation involved in ureteric bud branching, the growth of a branch of the ureteric bud along its axis.
    GO:0042663    regulation of endodermal cell fate specification    Any process that mediates the specification of a cell into an endoderm cell.
    GO:0035565    regulation of pronephros size    Any process that modulates the size of a pronephric kidney.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0009743    response to carbohydrate    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a carbohydrate stimulus.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0009749    response to glucose    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucose stimulus.
    GO:0014070    response to organic cyclic compound    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic cyclic compound stimulus.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0060677    ureteric bud elongation    The developmental growth in which the ureteric bud grows along its axis beginning with the growth of the primary ureteric bud and ending when the branches of the bud have elongated.
cellular component
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0005667    transcription factor complex    A protein complex that is capable of associating with DNA by direct binding, or via other DNA-binding proteins or complexes, and regulating transcription.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2h8r)
 
  Sites
(no "Sites" information available for 2h8r)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2h8r)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2h8r
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HNF1B_HUMAN | P35680
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  137920
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HNF1B_HUMAN | P35680
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HNF1B_HUMAN | P35680: 2da6 5k9s

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2H8R)