Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF IRDITOXIN
 
Authors :  J. Pawlak, R. M. Kini, E. A. Stura, M. H. Le Du
Date :  06 Jun 06  (Deposition) - 29 Aug 06  (Release) - 05 Oct 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Three-Finger Toxin, Neurotoxin, Snake Venom, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Pawlak, S. P. Mackessy, N. M. Sixberry, E. A. Stura, M. H. Le Du, R. Menez, C. S. Foo, A. Menez, S. Nirthanan, R. M. Kini
Irditoxin, A Novel Covalently Linked Heterodimeric Three-Finger Toxin With High Taxon-Specific Neurotoxicity.
Faseb J. V. 23 534 2009
PubMed-ID: 18952712  |  Reference-DOI: 10.1096/FJ.08-113555
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - IRDITOXIN SUBUNIT A
    Chains: A
    Organism Scientific: BOIGA IRREGULARIS
    Organism Taxid: 92519
 
Molecule 2 - IRDITOXIN SUBUNIT B
    Chains: B
    Organism Scientific: BOIGA IRREGULARIS
    Organism Taxid: 92519

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2H7Z)

(-) Sites  (0, 0)

(no "Site" information available for 2H7Z)

(-) SS Bonds  (11, 11)

Asymmetric/Biological Unit
No.Residues
1A:10 -A:32
2A:13 -A:21
3A:27 -A:51
4A:42 -B:18
5A:55 -A:66
6A:67 -A:72
7B:10 -B:34
8B:13 -B:21
9B:27 -B:53
10B:57 -B:68
11B:69 -B:74

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2H7Z)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2H7Z)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SNAKE_TOXINPS00272 Snake toxins signature.3NBA_BOIIR84-104  1A:50-70
3NBB_BOIIR86-106  1B:52-72

(-) Exons   (0, 0)

(no "Exon" information available for 2H7Z)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:75
 aligned with 3NBA_BOIIR | A0S864 from UniProtKB/Swiss-Prot  Length:109

    Alignment length:75
                                    44        54        64        74        84        94       104     
           3NBA_BOIIR    35 QAVGPPYTLCFECNRMTSSDCSTALRCYRGSCYTLYRPDENCELKWAVKGCAETCPTAGPNERVKCCRSPRCNDD 109
               SCOP domains d2h7za1 A:1-75 Irditoxin subunit A                                          SCOP domains
               CATH domains --------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeee.ee.........eeee...eeeeeeee.....eeeeeeeee..........eeeee........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------SNAKE_TOXIN          ----- PROSITE
                 Transcript --------------------------------------------------------------------------- Transcript
                 2h7z A   1 QAVGPPYTLCFECNRMTSSDCSTALRCYRGSCYTLYRPDENCELKWAVKGCAETCPTAGPNERVKCCRSPRCNDD  75
                                    10        20        30        40        50        60        70     


Chain B from PDB  Type:PROTEIN  Length:77
 aligned with 3NBB_BOIIR | A0S865 from UniProtKB/Swiss-Prot  Length:111

    Alignment length:77
                                    44        54        64        74        84        94       104       
           3NBB_BOIIR    35 QAKGPPYTLCFECNRETCSNCFKDNRCPPYHRTCYTLYRPDGNGEMKWAVKGCAKTCPTAQPGESVQCCNTPKCNDY 111
               SCOP domains d2h7zb1 B:1-77 Irditoxin subunit B                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........ee..ee..........ee......eeeeeeee.....eeeeeeeee..........eeeee........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------------------------------------SNAKE_TOXIN          ----- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------- Transcript
                 2h7z B   1 QAKGPPYTLCFECNRETCSNCFKDNRCPPYHRTCYTLYRPDGNGEMKWAVKGCAKTCPTAQPGESVQCCNTPKCNDY  77
                                    10        20        30        40        50        60        70
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric/Biological Unit
(-)
Class: Small proteins (3458)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2H7Z)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2H7Z)

(-) Gene Ontology  (5, 10)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (3NBA_BOIIR | A0S864)
molecular function
    GO:0030550    acetylcholine receptor inhibitor activity    Interacting (directly or indirectly) with acetylcholine receptors such that the proportion of receptors in the active form is decreased.
biological process
    GO:2000272    negative regulation of receptor activity    Any process that stops, prevents or reduces the frequency, rate or extent of receptor activity.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0035792    other organism postsynaptic membrane    A postsynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A postsynaptic membrane is a specialized area of membrane facing the presynaptic membrane on the tip of the nerve ending and separated from it by a minute cleft (the synaptic cleft). Neurotransmitters transmit the signal across the synaptic cleft to the postsynaptic membrane.

Chain B   (3NBB_BOIIR | A0S865)
molecular function
    GO:0030550    acetylcholine receptor inhibitor activity    Interacting (directly or indirectly) with acetylcholine receptors such that the proportion of receptors in the active form is decreased.
biological process
    GO:2000272    negative regulation of receptor activity    Any process that stops, prevents or reduces the frequency, rate or extent of receptor activity.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0035792    other organism postsynaptic membrane    A postsynaptic membrane that is part of another organism, i.e. a secondary organism with which the first organism is interacting. A postsynaptic membrane is a specialized area of membrane facing the presynaptic membrane on the tip of the nerve ending and separated from it by a minute cleft (the synaptic cleft). Neurotransmitters transmit the signal across the synaptic cleft to the postsynaptic membrane.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2h7z)
 
  Sites
(no "Sites" information available for 2h7z)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2h7z)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2h7z
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  3NBA_BOIIR | A0S864
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  3NBB_BOIIR | A0S865
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  3NBA_BOIIR | A0S864
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  3NBB_BOIIR | A0S865
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2H7Z)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2H7Z)