|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2H3A) |
Sites (0, 0)| (no "Site" information available for 2H3A) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2H3A) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2H3A) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2H3A) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2H3A) |
Exons (0, 0)| (no "Exon" information available for 2H3A) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:72 aligned with CCDA_ECOLI | P62552 from UniProtKB/Swiss-Prot Length:72 Alignment length:72 10 20 30 40 50 60 70 CCDA_ECOLI 1 MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKAENQEGMAEVARFIEMNGSFADENRDW 72 SCOP domains ------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------ Transcript 2h3a A 1 MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKVENQEGMVEVARFIEMNGSFADENKDW 72 10 20 30 40 50 60 70 Chain B from PDB Type:PROTEIN Length:72 aligned with CCDA_ECOLI | P62552 from UniProtKB/Swiss-Prot Length:72 Alignment length:72 10 20 30 40 50 60 70 CCDA_ECOLI 1 MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKAENQEGMAEVARFIEMNGSFADENRDW 72 SCOP domains ------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------ Transcript 2h3a B 101 MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWKVENQEGMVEVARFIEMNGSFADENKDW 172 110 120 130 140 150 160 170
Chain C from PDB Type:DNA Length:13
2h3a C 173 ATATGTATACCCG 185
182
Chain D from PDB Type:DNA Length:13
2h3a D 186 TCGGGTATACATA 198
195
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2H3A) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2H3A) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2H3A) |
Gene Ontology (3, 3)|
NMR Structure(hide GO term definitions) Chain A,B (CCDA_ECOLI | P62552)
|
||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|