Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN ROTAVIRUS NSP2 (GROUP C / BRISTOL STRAIN)
 
Authors :  X. Jiang, B. V. V. Prasad
Date :  28 Apr 06  (Deposition) - 19 Sep 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (4x)
Keywords :  Nsp2, Rotavirus, Hit Motif, Bristol, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Z. F. Taraporewala, X. Jiang, R. Vasquez-Del Carpio, H. Jayaram, B. V. V. Prasad, J. T. Patton
Structure-Function Analysis Of Rotavirus Nsp2 Octamer By Using A Novel Complementation System
J. Virol. V. 80 7984 2006
PubMed-ID: 16873255  |  Reference-DOI: 10.1128/JVI.00172-06
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - NONSTRUCTURAL PROTEIN 2
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPQE60
    Expression System StrainSG13009
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneNSP2, SEGMENT 9
    Organism ScientificHUMAN ROTAVIRUS C
    Organism Taxid10943
    StrainBRISTOL

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (4x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2GU0)

(-) Sites  (0, 0)

(no "Site" information available for 2GU0)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2GU0)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2GU0)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2GU0)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2GU0)

(-) Exons   (0, 0)

(no "Exon" information available for 2GU0)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:301
 aligned with NSP2_ROTHC | Q9PY93 from UniProtKB/Swiss-Prot  Length:312

    Alignment length:308
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301        
           NSP2_ROTHC     2 AELACFVSFSLTEDKVVWYPINKKAVQTMLCAKVEKDQRSNYYDTILYGVAPPPEFRNRFKTNERYGLDYESDQYTELVNLLADTLNMVSMPTEKFQFDIVKTVVQVRHLENLLCRIKDVNDILNANVKLRVKAVMIACNLVNETETTPLTESNDIVYQDSYFTITKLDYSNHKLLPLMADEYKITINTKTDIPDRNQTAFAAYIRYNFNKFAAISHGKRHWRLVLHSQLMSHAERLDRKIKSDKKHGRQFSYDDGDMAFVHPGWKTCIGQLCGGTTFEVAKTSLYSIKPSKTVRTATNKIESDLISM 309
               SCOP domains d2gu0a1 A:2-143 automated matches                                                                                                             d2gu0a2 A:144-309 automated matches                                                                                                                                    SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhh.eeee......eeee.hhhhhhhhhhh..hhhhh...ee.....ee.hhhhhhhh...........hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.......hhhhh....eeee...eeeeeee...........eeeeeee......hhhhhhhhhhhhhhhh..eeee.....eeeeee..hhhhhhhhhhhhhhh..-------.........hhhhhhhhhhhhhh.hhhhhhhhhhhh..hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2gu0 A   2 AELACFVSFSLTEDKVVWYPINKKAVQTMLCAKVEKDQRSNYYDTILYGVAPPPEFRNRFKTNERYGLDYESDQYTELVNLLADTLNMVSMPTEKFQFDIVKTVVQVRHLENLLCRIKDVNDILNANVKLRVKAVMIACNLVNETETTPLTESNDIVYQDSYFTITKLDYSNHKLLPLMADEYKITINTKTDIPDRNQTAFAAYIRYNFNKFAAISHGKRHWRLVLHSQLMSHAERLDRKIKSDK-------YDDGDMAFVHPGWKTCIGQLCGGTTFEVAKTSLYSIKPSKTVRTATNKIESDLISM 309
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241    |    -  |    261       271       281       291       301        
                                                                                                                                                                                                                                                                              246     254                                                       

Chain B from PDB  Type:PROTEIN  Length:301
 aligned with NSP2_ROTHC | Q9PY93 from UniProtKB/Swiss-Prot  Length:312

    Alignment length:308
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301        
           NSP2_ROTHC     2 AELACFVSFSLTEDKVVWYPINKKAVQTMLCAKVEKDQRSNYYDTILYGVAPPPEFRNRFKTNERYGLDYESDQYTELVNLLADTLNMVSMPTEKFQFDIVKTVVQVRHLENLLCRIKDVNDILNANVKLRVKAVMIACNLVNETETTPLTESNDIVYQDSYFTITKLDYSNHKLLPLMADEYKITINTKTDIPDRNQTAFAAYIRYNFNKFAAISHGKRHWRLVLHSQLMSHAERLDRKIKSDKKHGRQFSYDDGDMAFVHPGWKTCIGQLCGGTTFEVAKTSLYSIKPSKTVRTATNKIESDLISM 309
               SCOP domains d2gu0b1 B:2-143 automated matches                                                                                                             d2gu0b2 B:144-309 automated matches                                                                                                                                    SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhh.eeee......eeee.hhhhhhhhhhh..hhhhh...ee.....ee.hhhhhhhh...........hhhhhhhhhhhhhhhhhhh.hhhhhhhhhh....hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.......hhhhh....eeee...eeeeee.............eeeeee......hhhhhhhhhhhhhhhh..eeee.....eeeeee..hhhhhhhhhhhhhh...-------.........hhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2gu0 B   2 AELACFVSFSLTEDKVVWYPINKKAVQTMLCAKVEKDQRSNYYDTILYGVAPPPEFRNRFKTNERYGLDYESDQYTELVNLLADTLNMVSMPTEKFQFDIVKTVVQVRHLENLLCRIKDVNDILNANVKLRVKAVMIACNLVNETETTPLTESNDIVYQDSYFTITKLDYSNHKLLPLMADEYKITINTKTDIPDRNQTAFAAYIRYNFNKFAAISHGKRHWRLVLHSQLMSHAERLDRKIKSDK-------YDDGDMAFVHPGWKTCIGQLCGGTTFEVAKTSLYSIKPSKTVRTATNKIESDLISM 309
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241    |    -  |    261       271       281       291       301        
                                                                                                                                                                                                                                                                              246     254                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2GU0)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2GU0)

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (NSP2_ROTHC | Q9PY93)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016817    hydrolase activity, acting on acid anhydrides    Catalysis of the hydrolysis of any acid anhydride.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0019079    viral genome replication    Any process involved directly in viral genome replication, including viral nucleotide metabolism.
cellular component
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2gu0)
 
  Sites
(no "Sites" information available for 2gu0)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2gu0)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2gu0
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  NSP2_ROTHC | Q9PY93
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  NSP2_ROTHC | Q9PY93
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2GU0)

(-) Related Entries Specified in the PDB File

1l9v