Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - manually
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - manually
NMR Structure - manually  (Jmol Viewer)
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE LOW MOLECULAR WEIGHT PROTEIN TYROSINE PHOSPHATASE FROM CAMPYLOBACTER JEJUNI.
 
Authors :  D. Tolkatchev, R. Shaykhutdinov, P. Xu, F. Ni
Date :  28 Mar 06  (Deposition) - 18 Apr 06  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Low Molecular Weight, Protein Tyrosine Phosphatase, Bacterial Phosphatase, Prokaryotic Phosphatase, Phosphatase, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Tolkatchev, R. Shaykhutdinov, P. Xu, J. Plamondon, D. C. Watson, N. M. Young, F. Ni
Three-Dimensional Structure And Ligand Interactions Of The Low Molecular Weight Protein Tyrosine Phosphatase From Campylobacter Jejuni.
Protein Sci. V. 15 2381 2006
PubMed-ID: 17008719  |  Reference-DOI: 10.1110/PS.062279806
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - POSSIBLE PHOSPHOTYROSINE PROTEIN PHOSPHATASE
    ChainsA
    EC Number3.1.3.48
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPCWORI+
    Expression System StrainAD202, BL21(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneCJ1258
    Organism ScientificCAMPYLOBACTER JEJUNI
    Organism Taxid197
    Strain11168

 Structural Features

(-) Chains, Units

  
NMR Structure (10x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2GI4)

(-) Sites  (0, 0)

(no "Site" information available for 2GI4)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2GI4)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2GI4)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2GI4)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2GI4)

(-) Exons   (0, 0)

(no "Exon" information available for 2GI4)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:156
 aligned with Q0P8Z8_CAMJE | Q0P8Z8 from UniProtKB/TrEMBL  Length:151

    Alignment length:156
                                                                                                                                                                                151     
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150|     
         Q0P8Z8_CAMJE     1 MKKILFICLGNICRSPMAEFIMKDLVKKANLEKEFFINSAGTSGEHDGEGMHYGTKNKLAQLNIEHKNFTSKKLTQKLCDESDFLITMDNSNFKNVLKNFTNTQNKVLKITDFSPSLNYDEVPDPWYSGNFDETYKILSLACKNLLVFLSK-----   -
               SCOP domains d2gi4a_ A: automated matches                                                                                                                                 SCOP domains
               CATH domains 2gi4A00 A:1-156  [code=3.40.50.270, no name defined]                                                                                                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeee.....hhhhhhhhhhhhhhhhhh.....eeeee...........hhhhhhhhhhh............hhhhhh...eee..hhhhhhhhhhhhhhhhh.ee..............hhhhhh..hhhhhhhhhhhhhhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2gi4 A   1 MKKILFICLGNICRSPMAEFIMKDLVKKANLEKEFFINSAGTSGEHDGEGMHYGTKNKLAQLNIEHKNFTSKKLTQKLCDESDFLITMDNSNFKNVLKNFTNTQNKVLKITDFSPSLNYDEVPDPWYSGNFDETYKILSLACKNLLVFLSKHHHHH 156
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2GI4)

(-) Gene Ontology  (3, 3)

NMR Structure(hide GO term definitions)
Chain A   (Q0P8Z8_CAMJE | Q0P8Z8)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0004725    protein tyrosine phosphatase activity    Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
    GO:0035335    peptidyl-tyrosine dephosphorylation    The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2gi4)
 
  Sites
(no "Sites" information available for 2gi4)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2gi4)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2gi4
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q0P8Z8_CAMJE | Q0P8Z8
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  3.1.3.48
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q0P8Z8_CAMJE | Q0P8Z8
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2GI4)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2GI4)