|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 7)| Asymmetric/Biological Unit (2, 7) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2GFF) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2GFF) |
PROSITE Motifs (1, 2)
Asymmetric/Biological Unit (1, 2)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2GFF) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:97 aligned with LSRG_YERPE | Q7CG46 from UniProtKB/Swiss-Prot Length:96 Alignment length:97 96 10 20 30 40 50 60 70 80 90 | LSRG_YERPE 1 MHVTLVEINVKEDKVDQFIEVFRANHLGSIREAGNLRFDVLRDEHIPTRFYIYEAYTDEAAVAIHKTTPHYLQCVEQLAPLMTGPRKKTVFIGLMP- - SCOP domains d2gffa_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -ABM PDB: A:2-91 UniProt: 2-91 ------ PROSITE Transcript ------------------------------------------------------------------------------------------------- Transcript 2gff A 1 mHVTLVEINVKEDKVDQFIEVFRANHLGSIREAGNLRFDVLRDEHIPTRFYIYEAYTDEAAVAIHKTTPHYLQCVEQLAPLmTGPRKKTVFIGLmPG 97 | 10 20 30 40 50 60 70 80 | 90 | | 82-MSE 95-MSE 1-MSE Chain B from PDB Type:PROTEIN Length:100 aligned with LSRG_YERPE | Q7CG46 from UniProtKB/Swiss-Prot Length:96 Alignment length:100 96 10 20 30 40 50 60 70 80 90 | - LSRG_YERPE 1 MHVTLVEINVKEDKVDQFIEVFRANHLGSIREAGNLRFDVLRDEHIPTRFYIYEAYTDEAAVAIHKTTPHYLQCVEQLAPLMTGPRKKTVFIGLMP---- - SCOP domains d2gffb_ B: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -ABM PDB: B:2-91 UniProt: 2-91 --------- PROSITE Transcript ---------------------------------------------------------------------------------------------------- Transcript 2gff B 1 mHVTLVEINVKEDKVDQFIEVFRANHLGSIREAGNLRFDVLRDEHIPTRFYIYEAYTDEAAVAIHKTTPHYLQCVEQLAPLmTGPRKKTVFIGLmPGSLE 100 | 10 20 30 40 50 60 70 80 | 90 | 100 | 82-MSE 95-MSE 1-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2GFF) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2GFF) |
Gene Ontology (2, 2)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (LSRG_YERPE | Q7CG46)
|
||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|