Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AN UNCHARACTERIZED PROTEIN FROM CLOSTRIDIUM ACETOBUTYLICUM
 
Authors :  K. N. Rao, S. Swaminathan, S. K. Burley, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  25 Feb 06  (Deposition) - 14 Mar 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A,B  (2x)
Keywords :  Hypothetical Protein, Clostridium Acetobutylicum, T1230, Structural Genomics, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. N. Rao, S. Swaminathan
Crystal Structure Of An Uncharacterized Protein From Clostridium Acetobutylicum
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - UNCHARACTERIZED PROTEIN, HOMOLOG HI1244 FROM HAEMOPHILUS INFLUENZAE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: CLOSTRIDIUM ACETOBUTYLICUM
    Organism Taxid: 1488

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): AB
Biological Unit 2 (2x): AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 18)

Asymmetric Unit (2, 18)
No.NameCountTypeFull Name
1MSE16Mod. Amino AcidSELENOMETHIONINE
2UNK2Mod. Amino Acid
Biological Unit 1 (1, 16)
No.NameCountTypeFull Name
1MSE16Mod. Amino AcidSELENOMETHIONINE
2UNK-1Mod. Amino Acid
Biological Unit 2 (1, 32)
No.NameCountTypeFull Name
1MSE32Mod. Amino AcidSELENOMETHIONINE
2UNK-1Mod. Amino Acid

(-) Sites  (0, 0)

(no "Site" information available for 2G6T)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2G6T)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2G6T)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2G6T)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2G6T)

(-) Exons   (0, 0)

(no "Exon" information available for 2G6T)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:306
 aligned with Q97H28_CLOAB | Q97H28 from UniProtKB/TrEMBL  Length:305

    Alignment length:306
                                                                                                                                                                                                                                                                                                                                          305     
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300    | 
         Q97H28_CLOAB     1 MYKCLIWGVNDEYTLAYDKLLFEISKGNLSIEALISKDKYAKYIDGKEVIDKTEISNYEFDYIIIFNKERYSDIKNEALELGIPERKILNGKFFFISNFDFKRYCKLIENPITIISDDCWGGLVSSYLGFKFNSPFINFYIHNDDYIKFLENMDYYLEQELKVEQEGNVYSCTMPKGSLGTGDNKIILNFNHQASFAEAKNDWDERKTRINKKNLFVKMLIKDDNEKLVKRFDNLPYKNKVCFHPKPMKYKSVAFFPRYIWRCINYAARTSNSNLEQYTMDMSWLEKSCDILKMLCGEEDFIREK-   -
               SCOP domains d2g6ta1 A:1-305 Hypothetical protein CAC2185                                                                                                                                                                                                                                                                     - SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhhhhh..eeeeeee.............eehhhhhhhh...eeee....hhhhhhhhhhhh..hhh.ee.hhhhhh...hhhhhhhhhhh..eeee..hhhhhhhhhhh.........ee.hhhhhhhhhhhhhhhhhh........hhhhh...eeee......eeeee....hhhhhhhhhhhhhhhh....eeeeee....hhhhhhhhhh.....eeee............hhhhhhhhhhh.......hhhhhh.hhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2g6t A   1 mYKCLIWGVNDEYTLAYDKLLFEISKGNLSIEALISKDKYAKYIDGKEVIDKTEISNYEFDYIIIFNKERYSDIKNEALELGIPERKILNGKFFFISNFDFKRYCKLIENPITIISDDCWGGLVSSYLGFKFNSPFINFYIHNDDYIKFLENmDYYLEQELKVEQEGNVYSCTmPKGSLGTGDNKIILNFNHQASFAEAKNDWDERKTRINKKNLFVKmLIKDDNEKLVKRFDNLPYKNKVCFHPKPmKYKSVAFFPRYIWRCINYAARTSNSNLEQYTmDmSWLEKSCDILKmLCGEEDFIREKx 306
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150  |    160       170   |   180       190       200       210       220       230       240       250       260       270       280 |     290   |   300     |
                            |                                                                                                                                                     153-MSE              174-MSE                                      219-MSE                      248-MSE                         280-MSE       294-MSE     306-UNK
                            1-MSE                                                                                                                                                                                                                                                                                  282-MSE                    


Chain B from PDB  Type:PROTEIN  Length:306
 aligned with Q97H28_CLOAB | Q97H28 from UniProtKB/TrEMBL  Length:305

    Alignment length:306
                                                                                                                                                                                                                                                                                                                                          305     
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300    | 
         Q97H28_CLOAB     1 MYKCLIWGVNDEYTLAYDKLLFEISKGNLSIEALISKDKYAKYIDGKEVIDKTEISNYEFDYIIIFNKERYSDIKNEALELGIPERKILNGKFFFISNFDFKRYCKLIENPITIISDDCWGGLVSSYLGFKFNSPFINFYIHNDDYIKFLENMDYYLEQELKVEQEGNVYSCTMPKGSLGTGDNKIILNFNHQASFAEAKNDWDERKTRINKKNLFVKMLIKDDNEKLVKRFDNLPYKNKVCFHPKPMKYKSVAFFPRYIWRCINYAARTSNSNLEQYTMDMSWLEKSCDILKMLCGEEDFIREK-   -
               SCOP domains d2g6tb_ B: Hypothetical protein CAC2185                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .eeeeee..hhhhhhhhhhhhhhhhh..eeeeeee.......ee..eeee...hhhhh...eeee....hhhhhhhhhhhh..hhh.eee.hhhhh...hhhhhhhhhhh..eeee..hhhhhhhhhhh.........ee.hhhhhhhhhhhhhhhhh...eeee..hhhhh...eeee.hhhhheeeee....hhhhhhhhhhhhhhhhhhh.eeeeee....hhhhhhhhhh.....eeee.........ee.hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2g6t B   1 mYKCLIWGVNDEYTLAYDKLLFEISKGNLSIEALISKDKYAKYIDGKEVIDKTEISNYEFDYIIIFNKERYSDIKNEALELGIPERKILNGKFFFISNFDFKRYCKLIENPITIISDDCWGGLVSSYLGFKFNSPFINFYIHNDDYIKFLENmDYYLEQELKVEQEGNVYSCTmPKGSLGTGDNKIILNFNHQASFAEAKNDWDERKTRINKKNLFVKmLIKDDNEKLVKRFDNLPYKNKVCFHPKPmKYKSVAFFPRYIWRCINYAARTSNSNLEQYTmDmSWLEKSCDILKmLCGEEDFIREKx 306
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140       150  |    160       170   |   180       190       200       210       220       230       240       250       260       270       280 |     290   |   300     |
                            |                                                                                                                                                     153-MSE              174-MSE                                      219-MSE                      248-MSE                         280-MSE       294-MSE     306-UNK
                            1-MSE                                                                                                                                                                                                                                                                                  282-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2G6T)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2G6T)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2G6T)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    UNK  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2g6t)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2g6t)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2g6t
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q97H28_CLOAB | Q97H28
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q97H28_CLOAB | Q97H28
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2G6T)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2G6T)