Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN PTPA
 
Authors :  A. Magnusdottir, P. Stenmark, C. Arrowsmith, H. Berglund, R. Collins, A. Edwards, M. Ehn, S. Flodin, A. Flores, S. Graslund, M. Hammarstrom, B. M. Hallberg, M. Hogbom, L. Holmberg Schiavone, T. Kotenyova, P. Ni Ehle, T. Nyman, D. Ogg, C. Persson, J. Sagemark, M. Sundstrom, A. G. Tho S. Van Den Berg, K. Wallden, J. Weigelt, P. Nordlund
Date :  24 Feb 06  (Deposition) - 04 Apr 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A
Keywords :  Ppp2R4, Mgc2184, Pp2A, Pr53, Ptpa, Protein Phosphatase 2A, Regulatory Subunit B' (Pr 53), Hydrolase Activator (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. Magnusdottir, P. Stenmark, S. Flodin, T. Nyman, M. Hammarstrom, M. Ehn, M. A. Bakali H, H. Berglund, P. Nordlund
The Crystal Structure Of A Human Pp2A Phosphatase Activator Reveals A Novel Fold And Highly Conserved Cleft Implicated In Protein-Protein Interactions.
J. Biol. Chem. V. 281 22434 2006
PubMed-ID: 16782712  |  Reference-DOI: 10.1074/JBC.C600100200

(-) Compounds

Molecule 1 - PROTEIN PHOSPHATASE 2A, REGULATORY SUBUNIT B' (PR 53)
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPNIC-BSA4
    Expression System StrainBL21DE3
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GenePPP2R4
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymPPP2R4

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric/Biological Unit (2, 5)
No.NameCountTypeFull Name
1GOL1Ligand/IonGLYCEROL
2SO44Ligand/IonSULFATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREARG A:86 , TRP A:87 , LYS A:111 , HOH A:1813BINDING SITE FOR RESIDUE SO4 A 1403
2AC2SOFTWAREARG A:236 , HIS A:237 , LYS A:286 , GLN A:289 , HOH A:1534 , HOH A:1740 , HOH A:1793BINDING SITE FOR RESIDUE SO4 A 1404
3AC3SOFTWARELYS A:28 , GLN A:96 , PRO A:97 , SER A:98 , LYS A:103 , HOH A:1461 , HOH A:1504 , HOH A:1585 , HOH A:1643BINDING SITE FOR RESIDUE SO4 A 1405
4AC4SOFTWAREARG A:41 , ARG A:200BINDING SITE FOR RESIDUE SO4 A 1406
5AC5SOFTWAREGLY A:152 , THR A:153 , GLY A:154 , VAL A:305 , GLN A:307 , HIS A:308 , HOH A:1627 , HOH A:1646 , HOH A:1817BINDING SITE FOR RESIDUE GOL A 1407

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2G62)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2G62)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 3)

Asymmetric/Biological Unit (3, 3)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_028101K28RPTPA_HUMANPolymorphism17481693AK28R
2UniProtVAR_028102R208QPTPA_HUMANPolymorphism4836639AR173Q
3UniProtVAR_028103S357LPTPA_HUMANPolymorphism2480452AS322L

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2G62)

(-) Exons   (10, 10)

Asymmetric/Biological Unit (10, 10)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.2bENST000003377382bENSE00001420895chr9:131873613-131873910298PTPA_HUMAN1-11110--
1.7aENST000003377387aENSE00001757726chr9:131882792-13188288998PTPA_HUMAN11-43331A:15-4329
1.8ENST000003377388ENSE00001705154chr9:131885331-13188541787PTPA_HUMAN44-72291A:44-7027
1.9ENST000003377389ENSE00001632900chr9:131890243-131890347105PTPA_HUMAN73-107351A:71-722
1.10bENST0000033773810bENSE00001804284chr9:131891264-131891389126PTPA_HUMAN108-149421A:73-11442
1.11ENST0000033773811ENSE00002158657chr9:131893801-131893918118PTPA_HUMAN150-189401A:115-15440
1.12cENST0000033773812cENSE00001597590chr9:131897074-131897173100PTPA_HUMAN189-222341A:154-18734
1.13cENST0000033773813cENSE00001711396chr9:131898750-131898874125PTPA_HUMAN222-264431A:187-229 (gaps)43
1.14aENST0000033773814aENSE00001760922chr9:131899871-131899971101PTPA_HUMAN264-297341A:229-26234
1.19aENST0000033773819aENSE00002152224chr9:131904724-131904831108PTPA_HUMAN298-333361A:263-29836
1.21gENST0000033773821gENSE00001637868chr9:131909666-1319112231558PTPA_HUMAN334-358251A:299-32224

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:302
 aligned with PTPA_HUMAN | Q15257 from UniProtKB/Swiss-Prot  Length:358

    Alignment length:343
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354   
           PTPA_HUMAN    15 EAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS 357
               SCOP domains -------d2g62a1 A:22-322 Serine/threonine-protein phospha                                   tase 2A regulatory subunit B', PTPA                                                                                                                                                                                                                          SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ............ee...hhhhhhhhhhhhhhhhhhhhhhhhhhhh...........-----------------------------------hhhhhhhhhhhhhhhhhhhh............hhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh........eehhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh..ee.------......hhhhhhhhhhh......hhhhhhhhhhhhhhh..hhhhhhhhhhhhhh..hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhh..ee........... Sec.struct. author
                 SAPs(SNPs) -------------R-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Q----------------------------------------------------------------------------------------------------------------------------------------------------L SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.7a  PDB: A:15-43      Exon 1.8  PDB: A:44-70       Exon 1.9  PDB: A:71-72 [INCOMPLETE]Exon 1.10b  PDB: A:73-114 UniProt: 108-149Exon 1.11  PDB: A:115-154               --------------------------------Exon 1.13c  PDB: A:187-229 (gaps)          ---------------------------------Exon 1.19a  PDB: A:263-298          Exon 1.21g [INCOMPLETE]  Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.12c  PDB: A:154-187        -----------------------------------------Exon 1.14a  PDB: A:229-262        ------------------------------------------------------------ Transcript 1 (2)
                 2g62 A  15 NLYFQSRNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRV-----------------------------------SEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPA------GLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTS 322
                                    24        34        44        54        64     |   -         -         -         - |      79        89        99       109       119       129       139       149       159       169       179       189       199    |    - |     219       229       239       249       259       269       279       289       299       309       319   
                                                                                  70                                  71                                                                                                                                  204    211                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2G62)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2G62)

(-) Gene Ontology  (26, 26)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (PTPA_HUMAN | Q15257)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0016887    ATPase activity    Catalysis of the reaction: ATP + H2O = ADP + phosphate + 2 H+. May or may not be coupled to another reaction.
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0003755    peptidyl-prolyl cis-trans isomerase activity    Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).
    GO:0019211    phosphatase activator activity    Increases the activity of a phosphatase, an enzyme which catalyzes of the removal of a phosphate group from a substrate molecule.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0046982    protein heterodimerization activity    Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
    GO:0042803    protein homodimerization activity    Interacting selectively and non-covalently with an identical protein to form a homodimer.
    GO:0051721    protein phosphatase 2A binding    Interacting selectively and non-covalently with the enzyme protein phosphatase 2A.
    GO:0008160    protein tyrosine phosphatase activator activity    Increases the activity of a phosphatase, an enzyme which catalyzes of the removal of a phosphate group from a tyrosyl phenolic group of a protein.
    GO:0005102    receptor binding    Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
biological process
    GO:0030472    mitotic spindle organization in nucleus    A process resulting in the assembly, arrangement of constituent parts, or disassembly of the microtubule spindle in the nucleus. The process occurs during a mitotic cell cycle and takes place at the cellular level.
    GO:0032515    negative regulation of phosphoprotein phosphatase activity    Any process that stops or reduces the activity of a phosphoprotein phosphatase.
    GO:0035308    negative regulation of protein dephosphorylation    Any process the stops, prevents, or reduces the frequency, rate or extent of removal of phosphate groups from a protein.
    GO:0043065    positive regulation of apoptotic process    Any process that activates or increases the frequency, rate or extent of cell death by apoptotic process.
    GO:0032516    positive regulation of phosphoprotein phosphatase activity    Any process that activates or increases the activity of a phosphoprotein phosphatase.
    GO:0035307    positive regulation of protein dephosphorylation    Any process that activates or increases the frequency, rate or extent of removal of phosphate groups from a protein.
    GO:0000413    protein peptidyl-prolyl isomerization    The modification of a protein by cis-trans isomerization of a proline residue.
    GO:0043666    regulation of phosphoprotein phosphatase activity    Any process that modulates the frequency, rate or extent of phosphoprotein phosphatase activity, the catalysis of the hydrolysis of phosphate from a phosphoprotein.
cellular component
    GO:0034704    calcium channel complex    An ion channel complex through which calcium ions pass.
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005654    nucleoplasm    That part of the nuclear content other than the chromosomes or the nucleolus.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
    GO:0000159    protein phosphatase type 2A complex    A protein complex that has protein serine/threonine phosphatase activity that is polycation-stimulated (PCS), being directly stimulated by protamine, polylysine, or histone H1; it constitutes a subclass of several enzymes activated by different histones and polylysine, and consists of catalytic, scaffolding, and regulatory subunits. The catalytic and scaffolding subunits form the core enzyme, and the holoenzyme also includes the regulatory subunit.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2g62)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2g62
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PTPA_HUMAN | Q15257
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  PTPA_HUMAN | Q15257
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PTPA_HUMAN | Q152572hv6 2hv7 2ixm 4lac 4ny3

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2G62)