2G61 - JenaLib

Theor.Model - manually (Jmol Viewer)

Theoretical Model (Jmol Viewer)

Title :   THEARETICAL MODEL OF HSP-GRPE PROTEIN(BACILLUS SUBTILIS)

Authors :   M. Rajiniraja, K. Mani

Date :   24 Feb 06 (Deposition) - 07 Mar 06 (Release) - 07 Mar 06 (Revision)

Method :   THEORETICAL MODEL

Resolution :   NOT APPLICABLE

Chains :   Theor. Model : A

Keywords :   Grpe, Hsp, Chaperone, Bacillus Subtilis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Rajiniraja, K. Mani
Theoretical Model Of Hsp-Grpe Protein(Bacillus Subtilis)
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - PROTEIN GRPE
	Chains	:	A
	Organism Common	:	BACTERIA
	Organism Scientific	:	BACILLUS SUBTILIS
	Synonym	:	GRPE-HEAT SHOCK PROTEIN, HSP, HSP-70 COFACTOR


Theoretical Model	:

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2G61)

(no "Site" information available for 2G61)

(no "SS Bond" information available for 2G61)

(no "Cis Peptide Bond" information available for 2G61)

Theoretical Model (2, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_GRPE_BACSU_001 *	S	2	H	GRPE_BACSU	---	---	A	S	2	H
2	UniProt	VAR_GRPE_BACSU_002 *	K	5	T	GRPE_BACSU	---	---	A	K	5	T
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Theoretical Model (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GRPE	PS01071	grpE protein signature.	GRPE_BACSU	142-185	1	A:142-185

(no "Exon" information available for 2G61)

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:187
 aligned with GRPE_BACSU | P15874 from UniProtKB/Swiss-Prot  Length:187

    Alignment length:187
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       
           GRPE_BACSU     1 MSEEKQTVEQNETEEQEIIEEQAAADEQQEETNESELLQNQINELQGLLEEKENKLLRVQADFENYKRRSRLEMEASQKYRSQNIVTDLLPALDSFERALQVEADNEQTKSLLQGMEMVHRQLVEALKKEGVEAIEAVGQEFDPNLHQAVMQAEDENYGSNIVVEEMQKGYKLKDRVIRPSMVKVNQ 187
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhh.eeee...........eeeeeeee........eeee...eeee..eeee.eeeeeee Sec.struct. author
                 SAPs(SNPs) -H--T-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------GRPE  PDB: A:142-185 UniProt: 142-185       -- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2g61 A   1 MSEEKQTVEQNETEEQEIIEEQAAADEQQEETNESELLQNQINELQGLLEEKENKLLRVQADFENYKRRSRLEMEASQKYRSQNIVTDLLPALDSFERALQVEADNEQTKSLLQGMEMVHRQLVEALKKEGVEAIEAVGQEFDPNLHQAVMQAEDENYGSNIVVEEMQKGYKLKDRVIRPSMVKVNQ 187
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2G61)

(no "CATH Domain" information available for 2G61)

(no "Pfam Domain" information available for 2G61)

Theoretical Model(hide GO term definitions)

Chain A (GRPE_BACSU | P15874)

molecular function
	GO:0000774	adenyl-nucleotide exchange factor activity	Stimulates the hydrolysis and exchange of adenyl nucleotides by other proteins.
	GO:0051087	chaperone binding	Interacting selectively and non-covalently with a chaperone protein, a class of proteins that bind to nascent or unfolded polypeptides and ensure correct folding or transport.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0006457	protein folding	The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
	GO:0050790	regulation of catalytic activity	Any process that modulates the activity of an enzyme.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Theoretical Model
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2g61)

	Sites
(no "Sites" information available for 2g61)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2g61)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Theoretical Model PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2g61
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GRPE_BACSU \| P15874
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GRPE_BACSU \| P15874
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2G61)

(no "Related Entries Specified in the PDB File" available for 2G61)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 2)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File