2G59 - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Asym./Biol. Unit - sites (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF PROTEIN TYROSINE PHOSPHATASE FROM HOMO SAPIENS

Authors :   D. Kumaran, S. Swaminathan, S. K. Burley, New York Sgx Research Center For Structural Genomics (Nysgxrc)

Date :   22 Feb 06 (Deposition) - 14 Mar 06 (Release) - 25 Mar 08 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.19

Chains :   Asym./Biol. Unit : A,B

Keywords :   Protein Tyrosine Phosphatase, Dephosphorylation, Structural Genomics, Psi, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Nysgxrc, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. C. Almo, J. B. Bonanno, J. M. Sauder, S. Emtage, T. P. Dilorenzo, V. Malashkevich, S. R. Wasserman, S. Swaminathan, S. Eswaramoorthy, R. Agarwal, D. Kumaran, M. Madegowda, S. Ragumani, Y. Patskovsky, J. Alvarado, U. A. Ramagopal, J. Faber-Barata, M. R. Chance, A. Sali, A. Fiser, Z. Y. Zhang, D. S. Lawrence, S. K. Burley
Structural Genomics Of Protein Phosphatases.
J. Struct. Funct. Genom. V. 8 121 2007
PubMed-ID: 18058037 | Reference-DOI: 10.1007/S10969-007-9036-1
(for further references see the PDB file header)

Molecule 1 - RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE O
	Chains	:	A, B
	EC Number	:	3.1.3.48
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Fragment	:	PROTEIN TYROSINE PHOSPHATASE, CATALYTIC DOMAIN
	Gene	:	PTPRO, GLEPP1, PTPU2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	GLOMERULAR EPITHELIAL PROTEIN 1, PROTEIN TYROSINE PHOSPHATASE U2, PTPASE U2, PTP-U2

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric/Biological Unit (1, 2)

No.	Name	Count	Type	Full Name
1	PO4	2	Ligand/Ion	PHOSPHATE ION

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:191 , CYS A:225 , SER A:226 , ALA A:227 , GLY A:228 , VAL A:229 , GLY A:230 , ARG A:231 , GLN A:269 , HOH A:412	BINDING SITE FOR RESIDUE PO4 A 400
2	AC2	SOFTWARE	TYR A:57 , LYS A:135 , HIS A:192	BINDING SITE FOR RESIDUE PO4 A 401

(no "SS Bond" information available for 2G59)

(no "Cis Peptide Bond" information available for 2G59)

(no "SAP(SNP)/Variant" information available for 2G59)

Asymmetric/Biological Unit (3, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TYR_PHOSPHATASE_PTP	PS50055	PTP type protein phosphatase family profile.	PTPRO_HUMAN	938-1195	2	A:27-284 B:27-284
2	TYR_PHOSPHATASE_2	PS50056	Tyrosine specific protein phosphatases family profile.	PTPRO_HUMAN	1112-1186	2	A:201-275 B:201-275
3	TYR_PHOSPHATASE_1	PS00383	Tyrosine specific protein phosphatases active site.	PTPRO_HUMAN	1134-1144	2	A:223-233 B:223-233

Asymmetric/Biological Unit (9, 18)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000281171	1b	ENSE00001353280	chr12:15475487-15475735	249	PTPRO_HUMAN	1-25	25	0	-	-
1.2	ENST00000281171	2	ENSE00001122204	chr12:15636908-15637181	274	PTPRO_HUMAN	26-117	92	0	-	-
1.3	ENST00000281171	3	ENSE00001147171	chr12:15650179-15650337	159	PTPRO_HUMAN	117-170	54	0	-	-
1.4	ENST00000281171	4	ENSE00001147165	chr12:15652376-15652528	153	PTPRO_HUMAN	170-221	52	0	-	-
1.5	ENST00000281171	5	ENSE00001147160	chr12:15654554-15654997	444	PTPRO_HUMAN	221-369	149	0	-	-
1.6	ENST00000281171	6	ENSE00001147152	chr12:15656842-15657003	162	PTPRO_HUMAN	369-423	55	0	-	-
1.7	ENST00000281171	7	ENSE00001147146	chr12:15661505-15661701	197	PTPRO_HUMAN	423-488	66	0	-	-
1.8	ENST00000281171	8	ENSE00000999881	chr12:15668432-15668552	121	PTPRO_HUMAN	489-529	41	0	-	-
1.9	ENST00000281171	9	ENSE00001147141	chr12:15669697-15669890	194	PTPRO_HUMAN	529-593	65	0	-	-
1.10	ENST00000281171	10	ENSE00000999885	chr12:15673135-15673246	112	PTPRO_HUMAN	594-631	38	0	-	-
1.11	ENST00000281171	11	ENSE00002183053	chr12:15677748-15677899	152	PTPRO_HUMAN	631-681	51	0	-	-
1.12	ENST00000281171	12	ENSE00001777401	chr12:15679076-15679196	121	PTPRO_HUMAN	682-722	41	0	-	-
1.13b	ENST00000281171	13b	ENSE00001791853	chr12:15699503-15699642	140	PTPRO_HUMAN	722-768	47	0	-	-
1.14	ENST00000281171	14	ENSE00001703413	chr12:15702028-15702160	133	PTPRO_HUMAN	769-813	45	0	-	-
1.15	ENST00000281171	15	ENSE00001744436	chr12:15704485-15704605	121	PTPRO_HUMAN	813-853	41	0	-	-
1.16	ENST00000281171	16	ENSE00001708246	chr12:15710389-15710457	69	PTPRO_HUMAN	853-876	24	0	-	-
1.17	ENST00000281171	17	ENSE00001764566	chr12:15713127-15713210	84	PTPRO_HUMAN	876-904	29	0	-	-
1.18	ENST00000281171	18	ENSE00001779408	chr12:15718527-15718562	36	PTPRO_HUMAN	904-916	13	2	A:2-5 B:2-5	4 4
1.19	ENST00000281171	19	ENSE00001645479	chr12:15722351-15722432	82	PTPRO_HUMAN	916-943	28	2	A:5-32 B:5-32	28 28
1.20	ENST00000281171	20	ENSE00001636187	chr12:15731787-15731877	91	PTPRO_HUMAN	944-974	31	2	A:33-63 B:33-63	31 31
1.21	ENST00000281171	21	ENSE00001633246	chr12:15732973-15733049	77	PTPRO_HUMAN	974-999	26	2	A:63-88 B:63-88 (gaps)	26 26
1.22	ENST00000281171	22	ENSE00001781585	chr12:15733631-15733765	135	PTPRO_HUMAN	1000-1044	45	2	A:89-133 B:89-127	45 39
1.23	ENST00000281171	23	ENSE00001714929	chr12:15734613-15734735	123	PTPRO_HUMAN	1045-1085	41	2	A:134-174 B:137-174	41 38
1.24	ENST00000281171	24	ENSE00001712330	chr12:15739831-15739985	155	PTPRO_HUMAN	1086-1137	52	2	A:175-226 (gaps) B:175-226	52 52
1.25	ENST00000281171	25	ENSE00001696478	chr12:15742389-15742524	136	PTPRO_HUMAN	1137-1182	46	2	A:226-271 B:226-271	46 46
1.26a	ENST00000281171	26a	ENSE00001769993	chr12:15747871-15747991	121	PTPRO_HUMAN	1183-1216	34	2	A:272-291 B:272-296	20 25
1.26c	ENST00000281171	26c	ENSE00001147177	chr12:15749024-15750335	1312	PTPRO_HUMAN	-	0	0	-	-

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:287
 aligned with PTPRO_HUMAN | Q16827 from UniProtKB/Swiss-Prot  Length:1216

    Alignment length:290
                                   922       932       942       952       962       972       982       992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202
         PTPRO_HUMAN    913 KLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQ 1202
               SCOP domains d2g59a_ A: automated matches                                                                                                                                                                                                                                                                       SCOP domains
               CATH domains 2g59A00 A:2-291 Protein tyrosine phosphatase superfamily                                                                                                                                                                                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....ee..hhhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh............................eeee........eeee...hhhhhhhhhhhhhhh...eeee....ee..ee............eee..eeeeeeeeee...eeeeeeeeee..eeeeeeeeee..........---hhhhhhhhhhhhhhhh.....eeee....hhhhhhhhhhhhhhhhhhhh.eehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------TYR_PHOSPHATASE_PTP  PDB: A:27-284 UniProt: 938-1195                                                                                                                                                                                                              ------- PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: A:201-275 UniProt: 1112-1186                       ---------------- PROSITE (2)
                PROSITE (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA---------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.18---------------------------Exon 1.20  PDB: A:33-63        -------------------------Exon 1.22  PDB: A:89-133 UniProt: 1000-1044  Exon 1.23  PDB: A:134-174                Exon 1.24  PDB: A:175-226 (gaps) UniProt: 1086-1137 ---------------------------------------------Exon 1.26a           Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.19  PDB: A:5-32      ------------------------------Exon 1.21  PDB: A:63-88   -----------------------------------------------------------------------------------------------------------------------------------------Exon 1.25  PDB: A:226-271 UniProt: 1137-1182  -------------------- Transcript 1 (2)
                2g59 A    2 SLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPT---AESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKEG  291
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191    |  201       211       221       231       241       251       261       271       281       291
                                                                                                                                                                                                                            196 200

Chain B from PDB  Type:PROTEIN  Length:282
 aligned with PTPRO_HUMAN | Q16827 from UniProtKB/Swiss-Prot  Length:1216

    Alignment length:295
                                   922       932       942       952       962       972       982       992      1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202     
         PTPRO_HUMAN    913 KLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQFCISD 1207
               SCOP domains d2g59b_ B: automated matches                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 2g59B00 B:2-296 Protein tyrosine phosphatase superfamily                                                                                                                                                                                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....ee..hhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhh................----........eeee........eeeee..hhhhhhhhhhhhhhh...eeee...---------..........eee..eeeeeeeeee...eeeeeeeeee..eeeeeeeeee.........hhhhhhhhhhhhhhhhhhhh.....eeeee...hhhhhhhhhhhhhhhhhhhh.eehhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -------------------------TYR_PHOSPHATASE_PTP  PDB: B:27-284 UniProt: 938-1195                                                                                                                                                                                                              ------------ PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHATASE_2  PDB: B:201-275 UniProt: 1112-1186                       --------------------- PROSITE (2)
                PROSITE (3) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TYR_PHOSPHA--------------------------------------------------------------- PROSITE (3)
           Transcript 1 (1) 1.18---------------------------Exon 1.20  PDB: B:33-63        -------------------------Exon 1.22  PDB: B:89-127 UniProt: 1000-1044  Exon 1.23  PDB: B:137-174 [INCOMPLETE]   Exon 1.24  PDB: B:175-226 UniProt: 1086-1137        ---------------------------------------------Exon 1.26a  PDB: B:272-29 Transcript 1 (1)
           Transcript 1 (2) ---Exon 1.19  PDB: B:5-32      ------------------------------Exon 1.21 UniProt: 974-999-----------------------------------------------------------------------------------------------------------------------------------------Exon 1.25  PDB: B:226-271 UniProt: 1137-1182  ------------------------- Transcript 1 (2)
                2g59 B    2 SLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYDFSRVRLV----EEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQ---------DHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKEGHHHHH  296
                                    11        21        31        41        51        61        71    |   81        91       101       111       121     |   -     | 141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291     
                                                                                                71   76                                                127       137

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: (Phosphotyrosine protein) phosphatases II (296)

Superfamily: (Phosphotyrosine protein) phosphatases II (296)

Family: automated matches (83)

Protein domain: automated matches (83)

Human (Homo sapiens) [TaxId: 9606] (76)

1a	d2g59a_	A:
1b	d2g59b_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Protein-Tyrosine Phosphatase; Chain A (262)

Homologous Superfamily: Protein tyrosine phosphatase superfamily (228)

Human (Homo sapiens) (196)

1a	2g59B00	B:2-296
1b	2g59A00	A:2-291

(no "Pfam Domain" information available for 2G59)

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (PTPRO_HUMAN | Q16827)

molecular function
	GO:0017147	Wnt-protein binding	Interacting selectively and non-covalently with Wnt-protein, a secreted growth factor involved in signaling.
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0016791	phosphatase activity	Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0004721	phosphoprotein phosphatase activity	Catalysis of the reaction: a phosphoprotein + H2O = a protein + phosphate. Together with protein kinases, these enzymes control the state of phosphorylation of cell proteins and thereby provide an important mechanism for regulating cellular activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
	GO:0004725	protein tyrosine phosphatase activity	Catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
	GO:0005001	transmembrane receptor protein tyrosine phosphatase activity	Combining with a signal and transmitting the signal from one side of the membrane to the other to initiate a change in cell activity by catalysis of the reaction: protein tyrosine phosphate + H2O = protein tyrosine + phosphate.
biological process
	GO:0007411	axon guidance	The chemotaxis process that directs the migration of an axon growth cone to a specific target site in response to a combination of attractive and repulsive cues.
	GO:0000902	cell morphogenesis	The developmental process in which the size or shape of a cell is generated and organized.
	GO:0016311	dephosphorylation	The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
	GO:0072112	glomerular visceral epithelial cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of a glomerular visceral epithelial cell. A glomerular visceral epithelial cell is a specialized epithelial cell that contains "feet" that interdigitate with the "feet" of other glomerular epithelial cells.
	GO:0032835	glomerulus development	The progression of the glomerulus over time from its initial formation until its mature state. The glomerulus is a capillary tuft which forms a close network with the visceral epithelium (podocytes) and the mesangium to form the filtration barrier and is surrounded by Bowman's capsule in nephrons of the vertebrate kidney. The glomerulus is part of the nephron and is restricted to one body segment.
	GO:0030032	lamellipodium assembly	Formation of a lamellipodium, a thin sheetlike extension of the surface of a migrating cell.
	GO:0002548	monocyte chemotaxis	The movement of a monocyte in response to an external stimulus.
	GO:0090090	negative regulation of canonical Wnt signaling pathway	Any process that decreases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
	GO:0010812	negative regulation of cell-substrate adhesion	Any process that decreases the frequency, rate or extent of cell-substrate adhesion. Cell-substrate adhesion is the attachment of a cell to the underlying substrate via adhesion molecules.
	GO:0003105	negative regulation of glomerular filtration	Any process that stops, prevents, or reduces the frequency, rate or extent of glomerular filtration. Glomerular filtration is the processs whereby blood is filtered by the glomerulus into the renal tubule.
	GO:0010977	negative regulation of neuron projection development	Any process that decreases the rate, frequency or extent of neuron projection development. Neuron projection development is the process whose specific outcome is the progression of a neuron projection over time, from its formation to the mature structure. A neuron projection is any process extending from a neural cell, such as axons or dendrites (collectively called neurites).
	GO:0090260	negative regulation of retinal ganglion cell axon guidance	Any process that decreases the frequency, rate, or extent of retinal ganglion cell axon guidance, the process in which the migration of an axon growth cone of a retinal ganglion cell (RGC) is directed to its target in the brain in response to a combination of attractive and repulsive cues.
	GO:0035335	peptidyl-tyrosine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-tyrosine to form peptidyl-tyrosine.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0003093	regulation of glomerular filtration	Any process that modulates the frequency, rate or extent of glomerular filtration. Glomerular filtration is the process in which blood is filtered by the glomerulus into the renal tubule.
	GO:0036060	slit diaphragm assembly	The aggregation, arrangement and bonding together of a set of components to form a slit diaphragm, specialized cell-cell junction found between the interdigitating foot processes of the glomerular epithelium (the podocytes) in the vertebrate kidney, which is adapted for facilitating glomerular filtration.
cellular component
	GO:0016324	apical plasma membrane	The region of the plasma membrane located at the apical end of the cell.
	GO:0030424	axon	The long process of a neuron that conducts nerve impulses, usually away from the cell body to the terminals and varicosities, which are sites of storage and release of neurotransmitter.
	GO:0043197	dendritic spine	A small, membranous protrusion from a dendrite that forms a postsynaptic compartment - typically receiving input from a single presynapse. They function as partially isolated biochemical and an electrical compartments. Spine morphology is variable including "thin", "stubby", "mushroom", and "branched", with a continuum of intermediate morphologies. They typically terminate in a bulb shape, linked to the dendritic shaft by a restriction. Spine remodeling is though to be involved in synaptic plasticity.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0030426	growth cone	The migrating motile tip of a growing nerve cell axon or dendrite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0030027	lamellipodium	A thin sheetlike process extended by the leading edge of a migrating cell or extending cell process; contains a dense meshwork of actin filaments.
	GO:0016328	lateral plasma membrane	The portion of the plasma membrane at the lateral side of the cell. In epithelial cells, lateral plasma membranes are on the sides of cells which lie at the interface of adjacent cells.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0043005	neuron projection	A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		PO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2g59)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format \| Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2g59
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PTPRO_HUMAN \| Q16827
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.48
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PTPRO_HUMAN \| Q16827
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PTPRO_HUMAN \| Q16827	:	2gjt

(no "Related Entries Specified in the PDB File" available for 2G59)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (2, 2)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (3, 6)

Exons (9, 18)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (36, 36)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File