Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HUMAN DNA POLYMERASE GAMMA ACCESSORY SUBUNIT
 
Authors :  L. Fan, C. L. Farr, L. S. Kaguni, J. A. Tainer
Date :  22 Feb 06  (Deposition) - 18 Apr 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  3.15
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,C  (1x)
Biol. Unit 2:  B,D  (1x)
Keywords :  Alpha And Beta Protein, Anti-Codon Binding Domain-Like, Aars Class Ii-Like, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  L. Fan, S. Kim, C. L. Farr, K. T. Schaefer, K. M. Randolph, J. A. Tainer, L. S. Kaguni
A Novel Processive Mechanism For Dna Synthesis Revealed By Structure, Modeling And Mutagenesis Of The Accessory Subunit Of Human Mitochondrial Dna Polymerase
J. Mol. Biol. V. 358 1229 2006
PubMed-ID: 16574152  |  Reference-DOI: 10.1016/J.JMB.2006.02.073
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - DNA POLYMERASE GAMMA SUBUNIT 2
    Chains: A, B, C, D
    EC Number: 2.7.7.7
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Plasmid: PQESL-HP55
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Expression System Vector Type: PLASMID
    Gene: POLG2, MTPOLB
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606
    Synonym: MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT, POLG-BETA, MTPOLB, DNA POLYMERASE GAMMA ACCESSORY 55 KDA SUBUNIT, P55

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A C 
Biological Unit 2 (1x):  B D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2G4C)

(-) Sites  (0, 0)

(no "Site" information available for 2G4C)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2G4C)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric Unit
No.Residues
1Leu A:204 -Pro A:205
2Leu B:204 -Pro B:205
3Leu C:204 -Pro C:205
4Leu D:204 -Pro D:205

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (3, 12)

Asymmetric Unit (3, 12)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_032028A169TDPOG2_HUMANPolymorphism1427463A/B/C/DT169T
2UniProtVAR_032029G416ADPOG2_HUMANPolymorphism17850455A/B/C/DG416A
3UniProtVAR_029364G451EDPOG2_HUMANDisease (PEOA4)104894632A/B/C/DG451E
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 1 (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_032028A169TDPOG2_HUMANPolymorphism1427463A/CT169T
2UniProtVAR_032029G416ADPOG2_HUMANPolymorphism17850455A/CG416A
3UniProtVAR_029364G451EDPOG2_HUMANDisease (PEOA4)104894632A/CG451E
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)
Biological Unit 2 (3, 6)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_032028A169TDPOG2_HUMANPolymorphism1427463B/DT169T
2UniProtVAR_032029G416ADPOG2_HUMANPolymorphism17850455B/DG416A
3UniProtVAR_029364G451EDPOG2_HUMANDisease (PEOA4)104894632B/DG451E
  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2G4C)

(-) Exons   (0, 0)

(no "Exon" information available for 2G4C)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:397
 aligned with DPOG2_HUMAN | Q9UHN1 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:420
                                    75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485
          DPOG2_HUMAN    66 SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV 485
               SCOP domains d2g4ca2 A:66-355 The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain                                                                                                                                                                                                          d2g4ca1 A:369-485 The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain                SCOP domains
               CATH domains 2g4cA01 A:66-379 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                                                                      2g4cA02 A:380-485  [code=3.40.50.800, no name defined]                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhh..........hhhhhhh......hhhhhhhhhhhhhhhhhhhh.....eee.....ee...........eeeehhhhhhhh.......hhhhhhhhhhhhhh.ee...hhhhhhhhhhhhhhh.......eeeeeeeeeee.----------..eeeeeeeeeeeeehhhhhhhhhhhhhhhhhhhhhh...hhh.eeee...........eeeeee..eeeeeeeeee..hhhhhhhh..hhhhh.ee....ee..eeeeeeeehhhhhhhhhhhh..-------------..............eeeee......hhhhhhhhhhhhhhh....eee.........hhhhhhhhhhh...eeeeehhhhhh......ee.............hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------T------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A----------------------------------E---------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2g4c A  66 SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPV----------KSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQ-------------RKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV 485
                                    75        85        95       105       115       125       135       145       155       165       175       185       195       205       215  |      -   |   235       245       255       265       275       285       295       305       315       325       335       345       355         -   |   375       385       395       405       415       425       435       445       455       465       475       485
                                                                                                                                                                                  218        229                                                                                                                           355           369                                                                                                                    


Chain B from PDB  Type:PROTEIN  Length:397
 aligned with DPOG2_HUMAN | Q9UHN1 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:420
                                    75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485
          DPOG2_HUMAN    66 SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV 485
               SCOP domains d2g4cb2 B:66-355 The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain                                                                                                                                                                                                          d2g4cb1 B:369-485 The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain                SCOP domains
               CATH domains 2g4cB01 B:66-379 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                                                                      2g4cB02 B:380-485  [code=3.40.50.800, no name defined]                                                     CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhh..........hhhhhhh......hhhhhhhhhhhhhhhhhhhh.....eee.....ee...........eeeehhhhhhhh.......hhhhhhhhhhhhhheee...hhhhhhhhhhhhhhh.......eeeeeeeeeee.----------..eeeeeeeeeeeeehhhhhhhhhhhhhhhhhhhhhh...hhh.eeee...........eeeeee..eeeeeeeeee..hhhhhhhh..hhhhh.ee....ee..eeeeeeeehhhhhhhhhhhh..-------------..............eeeee......hhhhhhhhhhhhhhh....eee.........hhhhhhhhhhh...eeeeehhhhhh......ee.............hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------T------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A----------------------------------E---------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2g4c B  66 SEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPV----------KSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQ-------------RKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV 485
                                    75        85        95       105       115       125       135       145       155       165       175       185       195       205       215  |      -   |   235       245       255       265       275       285       295       305       315       325       335       345       355         -   |   375       385       395       405       415       425       435       445       455       465       475       485
                                                                                                                                                                                  218        229                                                                                                                           355           369                                                                                                                    


Chain C from PDB  Type:PROTEIN  Length:397
 aligned with DPOG2_HUMAN | Q9UHN1 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:419
                                    76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476         
          DPOG2_HUMAN    67 EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV 485
               SCOP domains d2g4cc2 C:67-355 The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain                                                                                                                                                                                                        d2g4cc1 C:368-485 The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain                 SCOP domains
               CATH domains 2g4cC01 C:67-379 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                                                                     2g4cC02 C:380-485  [code=3.40.50.800, no name defined]                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh..........hhhhhhhh.....hhhhhhhhhhhhhhhhhhhh......ee.....ee..........eeee....................hhhhhhhhhheee...hhhhhhhhhh...........eeeeeeeeee...----------....eeeeeeeeeeehhhhhhhhhhhhhhhhhhhhhhh..hhh.ee.............eeee......eeeeeeeeeehhhhhhhh...hhhhheee..eee..eeeeeeeehhhhhhhhhhhh..------------.......hhhhh...eeeee.......hhhhhhhhhhhhhh....eee.........hhhhhhhhhhh...eeeeehhhhhh...eee........eee...hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------T------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A----------------------------------E---------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2g4c C  67 EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPV----------KSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQ------------HRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV 485
                                    76        86        96       106       116       126       136       146       156       166       176       186       196       206       216 |       -  |    236       246       256       266       276       286       296       306       316       326       336       346        |-         - |     376       386       396       406       416       426       436       446       456       466       476         
                                                                                                                                                                                 218        229                                                                                                                           355          368                                                                                                                     


Chain D from PDB  Type:PROTEIN  Length:397
 aligned with DPOG2_HUMAN | Q9UHN1 from UniProtKB/Swiss-Prot  Length:485

    Alignment length:419
                                    76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476         
          DPOG2_HUMAN    67 EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV 485
               SCOP domains d2g4cd2 D:67-355 The aaRS-like accessory subunit of mitochondrial polymerase gamma, N-terminal domain                                                                                                                                                                                                        d2g4cd1 D:368-485 The aaRS-like accessory subunit of mitochondrial polymerase gamma, C-terminal domain                 SCOP domains
               CATH domains 2g4cD01 D:67-379 Bira Bifunctional Protein; Domain 2                                                                                                                                                                                                                                                                     2g4cD02 D:380-485  [code=3.40.50.800, no name defined]                                                     CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh..........hhhhhhhh.....hhhhhhhhhhhhhhhhhhhh......ee.....ee..........eeee....................hhhhhhhhhheee...hhhhhhhhhh...........eeeeeeeeee...----------....eeeeeeeeeeehhhhhhhhhhhhhhhhhhhhhhh..hhh.ee.............eeee......eeeeeeeeeehhhhhhhh...hhhhheee..eee..eeeeeeeehhhhhhhhhhhh..------------.......hhhhh...eeeee.......hhhhhhhhhhhhhh....eee.........hhhhhhhhhhh...eeeeehhhhhh...eee........eee...hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------T------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------A----------------------------------E---------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2g4c D  67 EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVTFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPV----------KSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQ------------HRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV 485
                                    76        86        96       106       116       126       136       146       156       166       176       186       196       206       216 |       -  |    236       246       256       266       276       286       296       306       316       326       336       346        |-         - |     376       386       396       406       416       426       436       446       456       466       476         
                                                                                                                                                                                 218        229                                                                                                                           355          368
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 8)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 8)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2G4C)

(-) Gene Ontology  (22, 22)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (DPOG2_HUMAN | Q9UHN1)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003887    DNA-directed DNA polymerase activity    Catalysis of the reaction: deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1); the synthesis of DNA from deoxyribonucleotide triphosphates in the presence of a DNA template and a 3'hydroxyl group.
    GO:0004820    glycine-tRNA ligase activity    Catalysis of the reaction: ATP + glycine + tRNA(Gly) = AMP + diphosphate + glycyl-tRNA(Gly).
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0071897    DNA biosynthetic process    The cellular DNA metabolic process resulting in the formation of DNA, deoxyribonucleic acid, one of the two main types of nucleic acid, consisting of a long unbranched macromolecule formed from one or two strands of linked deoxyribonucleotides, the 3'-phosphate group of each constituent deoxyribonucleotide being joined in 3',5'-phosphodiester linkage to the 5'-hydroxyl group of the deoxyribose moiety of the next one.
    GO:0006281    DNA repair    The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
    GO:0006260    DNA replication    The cellular metabolic process in which a cell duplicates one or more molecules of DNA. DNA replication begins when specific sequences, known as origins of replication, are recognized and bound by initiation proteins, and ends when the original DNA molecule has been completely duplicated and the copies topologically separated. The unit of replication usually corresponds to the genome of the cell, an organelle, or a virus. The template for replication can either be an existing DNA molecule or RNA.
    GO:0006261    DNA-dependent DNA replication    A DNA replication process that uses parental DNA as a template for the DNA-dependent DNA polymerases that synthesize the new strands.
    GO:0006426    glycyl-tRNA aminoacylation    The process of coupling glycine to glycyl-tRNA, catalyzed by glycyl-tRNA synthetase. In tRNA aminoacylation, the amino acid is first activated by linkage to AMP and then transferred to either the 2'- or the 3'-hydroxyl group of the 3'-adenosine residue of the tRNA.
    GO:0001701    in utero embryonic development    The process whose specific outcome is the progression of the embryo in the uterus over time, from formation of the zygote in the oviduct, to birth. An example of this process is found in Mus musculus.
    GO:0032042    mitochondrial DNA metabolic process    The chemical reactions and pathways involving mitochondrial DNA.
    GO:0070584    mitochondrion morphogenesis    The process in which the anatomical structures of a mitochondrion are generated and organized.
    GO:0007005    mitochondrion organization    A process that is carried out at the cellular level which results in the assembly, arrangement of constituent parts, or disassembly of a mitochondrion; includes mitochondrial morphogenesis and distribution, and replication of the mitochondrial genome as well as synthesis of new mitochondrial components.
    GO:0022904    respiratory electron transport chain    A process in which a series of electron carriers operate together to transfer electrons from donors such as NADH and FADH2 to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
cellular component
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0000262    mitochondrial chromosome    A chromosome found in the mitochondrion of a eukaryotic cell.
    GO:0005759    mitochondrial matrix    The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
    GO:0042645    mitochondrial nucleoid    The region of a mitochondrion to which the DNA is confined.
    GO:0005739    mitochondrion    A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2g4c)
 
  Sites
(no "Sites" information available for 2g4c)
 
  Cis Peptide Bonds
    Leu A:204 - Pro A:205   [ RasMol ]  
    Leu B:204 - Pro B:205   [ RasMol ]  
    Leu C:204 - Pro C:205   [ RasMol ]  
    Leu D:204 - Pro D:205   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2g4c
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  DPOG2_HUMAN | Q9UHN1
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.7.7
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  610131
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  DPOG2_HUMAN | Q9UHN1
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        DPOG2_HUMAN | Q9UHN1: 3ikl 3ikm 4ztu 4ztz 5c51 5c52 5c53

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2G4C)