Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A CONSERVED PROTEIN OF UNKNOWN FUNCTION FROM STREPTOCOCCUS PNEUMONIAE
 
Authors :  B. Nocek, C. Hatzos, J. Abdullah, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  08 Feb 06  (Deposition) - 21 Mar 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A,B,C  (2x)
Keywords :  Structural Genomics, Hypothetical Protein, Psi, Midwest Center For Structural Genomics, Mcsg, Protein Structure Initiative, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  B. Nocek, C. Hatzos, J. Abdullah, A. Jaochimiak
Crystal Structure Of A Conserved Hypothetical Protein From Streptococcus Pneumoniae Tigr4
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CONSERVED HYPOTHETICAL PROTEIN
    Chains: A, B, C
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PMCSG7
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: STREPTOCOCCUS PNEUMONIAE
    Organism Taxid: 170187
    Strain: TIGR4

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit : ABC
Biological Unit 1 (2x): ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 18)

Asymmetric Unit (1, 18)
No.NameCountTypeFull Name
1MSE18Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 36)
No.NameCountTypeFull Name
1MSE36Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2FYW)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FYW)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2FYW)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FYW)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2FYW)

(-) Exons   (0, 0)

(no "Exon" information available for 2FYW)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:267
 aligned with GCH1L_STRPN | Q97PK0 from UniProtKB/Swiss-Prot  Length:265

    Alignment length:267
                              1                                                                                                                                                                                                                                                                        
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       
          GCH1L_STRPN     - --MLASEVIQAYEAFCPQEFSMEGDSRGLQIGTLDKGIQRVMVALDIREETVAEAIEKGVDLIIVKHAPIFRPIKDLLASRPQNQIYIDLIKHDIAVYVSHTNIDIVENGLNDWFCQMLGIEETTYLQETGPERGIGRIGNIQPQTFWELAQQVKQVFDLDSLRMVHYQEDDLQKPISRVAICGGSGQSFYKDALAKGADVYITGDIYYHTAQDMLSDGLLALDPGHYIEVIFVEKIAALLSQWKEDKGWSIDILPSQASTNPFHHI 265
               SCOP domains --d2fywa1 A:1-265 Hypothetical protein SP1609                                                                                                                                                                                                                               SCOP domains
               CATH domains 2fywA01 A:-1-99,A:225-253 NIF3 (NGG1p interacting factor 3)-like                                     2fywA02 A:100-224 NIF3 (NGG1p interacting factor 3)-like                                                                     2fywA01 A:-1-99,A:225-253    ------------ CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhh......eeee........eeeee...hhhhhhhhhhh...eeee...............hhhhhhhhhhhhh..eeee.hhhhhhh..hhhhhhhhhhh.eeeeeeeeee..eeeeeeeeeeeeehhhhhhhhhhhh.....eee....hhhh.eeeeeeee...hhhhhhhhhhh...eeee...hhhhhhhhhhh..eeee.hhhhhhhhhhhhhhhhhhhhhhhh...eeee.......eee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fyw A  -1 NAmLASEVIQAYEAFCPQEFSmEGDSRGLQIGTLDKGIQRVmVALDIREETVAEAIEKGVDLIIVKHAPIFRPIKDLLASRPQNQIYIDLIKHDIAVYVSHTNIDIVENGLNDWFCQmLGIEETTYLQETGPERGIGRIGNIQPQTFWELAQQVKQVFDLDSLRmVHYQEDDLQKPISRVAICGGSGQSFYKDALAKGADVYITGDIYYHTAQDmLSDGLLALDPGHYIEVIFVEKIAALLSQWKEDKGWSIDILPSQASTNPFHHI 265
                              |      8        18 |      28        38 |      48        58        68        78        88        98       108       118       128       138       148       158    |  168       178       188       198       208    |  218       228       238       248       258       
                              |                 20-MSE              40-MSE                                                                     116-MSE                                        163-MSE                                           213-MSE                                                
                              1-MSE                                                                                                                                                                                                                                                                    


Chain B from PDB  Type:PROTEIN  Length:267
 aligned with GCH1L_STRPN | Q97PK0 from UniProtKB/Swiss-Prot  Length:265

    Alignment length:267
                              1                                                                                                                                                                                                                                                                        
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       
          GCH1L_STRPN     - --MLASEVIQAYEAFCPQEFSMEGDSRGLQIGTLDKGIQRVMVALDIREETVAEAIEKGVDLIIVKHAPIFRPIKDLLASRPQNQIYIDLIKHDIAVYVSHTNIDIVENGLNDWFCQMLGIEETTYLQETGPERGIGRIGNIQPQTFWELAQQVKQVFDLDSLRMVHYQEDDLQKPISRVAICGGSGQSFYKDALAKGADVYITGDIYYHTAQDMLSDGLLALDPGHYIEVIFVEKIAALLSQWKEDKGWSIDILPSQASTNPFHHI 265
               SCOP domains d2fywb_ B: Hypothetical protein SP1609                                                                                                                                                                                                                                      SCOP domains
               CATH domains 2fywB01 B:-1-99,B:225-253 NIF3 (NGG1p interacting factor 3)-like                                     2fywB02 B:100-224 NIF3 (NGG1p interacting factor 3)-like                                                                     2fywB01 B:-1-99,B:225-253    ------------ CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eehhhhhhhhhhhhhhhhh.....eeeee.....ee.eeeee...hhhhhhhhhhh...eeee...............hhhhhhhhhhhhh..eeeeehhhhhhh..hhhhhhhhhhh.eeee..eeee..eee.eeeeeeeeehhhhhhhhhhhh.....eee..hhhhhh.eeeeeeeeeee...hhhhhhhh...eeeee..hhhhhhhhhhh..eeee.hhhhhhhhhhhhhhhhhhhhhhhh...eeee.......eee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fyw B  -1 NAmLASEVIQAYEAFCPQEFSmEGDSRGLQIGTLDKGIQRVmVALDIREETVAEAIEKGVDLIIVKHAPIFRPIKDLLASRPQNQIYIDLIKHDIAVYVSHTNIDIVENGLNDWFCQmLGIEETTYLQETGPERGIGRIGNIQPQTFWELAQQVKQVFDLDSLRmVHYQEDDLQKPISRVAICGGSGQSFYKDALAKGADVYITGDIYYHTAQDmLSDGLLALDPGHYIEVIFVEKIAALLSQWKEDKGWSIDILPSQASTNPFHHI 265
                              |      8        18 |      28        38 |      48        58        68        78        88        98       108       118       128       138       148       158    |  168       178       188       198       208    |  218       228       238       248       258       
                              1-MSE             20-MSE              40-MSE                                                                     116-MSE                                        163-MSE                                           213-MSE                                                


Chain C from PDB  Type:PROTEIN  Length:266
 aligned with GCH1L_STRPN | Q97PK0 from UniProtKB/Swiss-Prot  Length:265

    Alignment length:266
                             1                                                                                                                                                                                                                                                                        
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259      
          GCH1L_STRPN     - -MLASEVIQAYEAFCPQEFSMEGDSRGLQIGTLDKGIQRVMVALDIREETVAEAIEKGVDLIIVKHAPIFRPIKDLLASRPQNQIYIDLIKHDIAVYVSHTNIDIVENGLNDWFCQMLGIEETTYLQETGPERGIGRIGNIQPQTFWELAQQVKQVFDLDSLRMVHYQEDDLQKPISRVAICGGSGQSFYKDALAKGADVYITGDIYYHTAQDMLSDGLLALDPGHYIEVIFVEKIAALLSQWKEDKGWSIDILPSQASTNPFHHI 265
               SCOP domains d2fywc_ C: Hypothetical protein SP1609                                                                                                                                                                                                                                     SCOP domains
               CATH domains 2fywC01 C:0-99,C:225-253 NIF3 (NGG1p interacting factor 3)-like                                     2fywC02 C:100-224 NIF3 (NGG1p interacting factor 3)-like                                                                     2fywC01 C:0-99,C:225-253     ------------ CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhh......eeee........eeeee...hhhhhhhhhhhh..eeee...............hhhhhhhhhhhhh..eeee..hhhhhh..hhhhhhhhhhh.eeeeeeeeee..eeeeeeeeeeeeehhhhhhhhhhhhh....eee..hhhhhh.eeeeeeee...hhhhhhhhhhh...eeee...hhhhhhhhhhh..eeee..hhhhhhhhhhhhhhhhhhhhhhh...eeee........... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fyw C   0 AmLASEVIQAYEAFCPQEFSmEGDSRGLQIGTLDKGIQRVmVALDIREETVAEAIEKGVDLIIVKHAPIFRPIKDLLASRPQNQIYIDLIKHDIAVYVSHTNIDIVENGLNDWFCQmLGIEETTYLQETGPERGIGRIGNIQPQTFWELAQQVKQVFDLDSLRmVHYQEDDLQKPISRVAICGGSGQSFYKDALAKGADVYITGDIYYHTAQDmLSDGLLALDPGHYIEVIFVEKIAALLSQWKEDKGWSIDILPSQASTNPFHHI 265
                             |       9        19|       29        39|       49        59        69        79        89        99       109      |119       129       139       149       159   |   169       179       189       199       209   |   219       229       239       249       259      
                             1-MSE             20-MSE              40-MSE                                                                     116-MSE                                        163-MSE                                           213-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 6)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FYW)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (GCH1L_STRPN | Q97PK0)
molecular function
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2fyw)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2fyw)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2fyw
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GCH1L_STRPN | Q97PK0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GCH1L_STRPN | Q97PK0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2FYW)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FYW)