Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE COFACTOR-BINDING DOMAIN OF THE CBL TRANSCRIPTIONAL REGULATOR
 
Authors :  E. Stec, P. Neumann, A. J. Wilkinson, A. M. Brzozowski, G. D. Bujacz
Date :  08 Feb 06  (Deposition) - 21 Feb 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  C  (2x)
Biol. Unit 3:  D  (2x)
Keywords :  Transcriptional Regulator, Lys-R Family, Cofactor-Binding Domain, Cysteine Biosynthesis, Transcription (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  E. Stec, M. Witkowska-Zimny, M. M. Hryniewicz, P. Neumann, A. J. Wilkinson, A. M. Brzozowski, C. S. Verma, J. Zaim, S. Wysocki, G. D Bujacz
Structural Basis Of The Sulphate Starvation Response In E. Coli: Crystal Structure And Mutational Analysis Of The Cofactor-Binding Domain Of The Cbl Transcriptional Regulator.
J. Mol. Biol. V. 364 309 2006
PubMed-ID: 17010379  |  Reference-DOI: 10.1016/J.JMB.2006.06.033

(-) Compounds

Molecule 1 - HTH-TYPE TRANSCRIPTIONAL REGULATOR CBL
    ChainsA, B, C, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET28
    Expression System StrainBL21-CODON PLUS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentCOFACTOR-BINDING DOMAIN, RESIDUES 88-307
    GeneCBL
    Organism ScientificESCHERICHIA COLI K12
    Organism Taxid83333
    StrainK-12

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (1x)AB  
Biological Unit 2 (2x)  C 
Biological Unit 3 (2x)   D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2FYI)

(-) Sites  (0, 0)

(no "Site" information available for 2FYI)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FYI)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2FYI)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FYI)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2FYI)

(-) Exons   (0, 0)

(no "Exon" information available for 2FYI)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:223
 aligned with CBL_ECOLI | Q47083 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:223
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304   
            CBL_ECOLI    85 DLFTNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES 307
               SCOP domains ---d2fyia1 A:88-307 LysR-type regulatory protein Cbl                                                                                                                                                                            SCOP domains
               CATH domains 2fyiA01 A:85-166,A:268-307 Periplasmic binding protein-like II                    2fyiA02 A:167-267 Periplasmic binding protein-like II                                                2fyiA01 A:85-166,A:268-307               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeehhhhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhh....eeee.........eeeeeeeee.eeeeee..hhhhh....hhhhhh...eeee.....hhhhhhhhhhhh.....eeeee.hhhhhhhhhhhh..eeeee.hhhh......eeee........eeeeeeee.....hhhhhhhhhhhh...hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fyi A  85 SHMTNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES 307
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304   

Chain B from PDB  Type:PROTEIN  Length:223
 aligned with CBL_ECOLI | Q47083 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:223
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304   
            CBL_ECOLI    85 DLFTNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES 307
               SCOP domains d2fyib_ B: LysR-type regulatory protein Cbl                                                                                                                                                                                     SCOP domains
               CATH domains 2fyiB01 B:85-166,B:268-307 Periplasmic binding protein-like II                    2fyiB02 B:167-267 Periplasmic binding protein-like II                                                2fyiB01 B:85-166,B:268-307               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeeehhhhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhh....eeee.........eeeeeeeee.eeeeee..hhhhhh...hhhhhh...eeee.....hhhhhhhhhhhh.....eeeee.hhhhhhhhhh....eeeee...........eeeee.......eeeeeeee.....hhhhhhhhhhhh...hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fyi B  85 SHMTNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES 307
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304   

Chain C from PDB  Type:PROTEIN  Length:228
 aligned with CBL_ECOLI | Q47083 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:259
                                    58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298         
            CBL_ECOLI    49 FVRRGKRLLGMTEPGKALLVIAERILNEASNVRRLADLFTNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES 307
               SCOP domains d2fyi                               c_ C: LysR-type regulatory protein Cbl                                                                                                                                                                                          SCOP domains
               CATH domains 2fyiC                               01 C:80-166,C:268-307 Periplasmic binding protein-like II                         2fyiC02 C:167-267 Periplasmic binding protein-like II                                                2fyiC01 C:80-166,C:268-307               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....-------------------------------........eeeeeeehhhhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhh....eeee.........eeeeeeeee.eeeeee..hhhhh....hhhhhh...eeee.....hhhhhhhhhhhh.....eeeee.hhhhhhhhhhhh..eeeee.hhh.......eeee........eeeeeeee.....hhhhhhhhhhhh...hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fyi C  80 LVPRG-------------------------------SHMTNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES 307
                                |    -         -         -      | 88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298         
                               84                              85                                                                                                                                                                                                                              

Chain D from PDB  Type:PROTEIN  Length:223
 aligned with CBL_ECOLI | Q47083 from UniProtKB/Swiss-Prot  Length:316

    Alignment length:223
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304   
            CBL_ECOLI    85 DLFTNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES 307
               SCOP domains d2fyid_ D: LysR-type regulatory protein Cbl                                                                                                                                                                                     SCOP domains
               CATH domains 2fyiD01 D:85-166,D:268-307 Periplasmic binding protein-like II                    2fyiD02 D:167-267 Periplasmic binding protein-like II                                                2fyiD01 D:85-166,D:268-307               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhh..eeeeeeehhhhhhhhhhhhhhhhhhhh..eeeeeee.hhhhhhhhhhh....eeee.........eeeeeeeee.eeeeee..hhhhhh...hhhhhh...eeee.....hhhhhhhhhhhh.....eeeee.hhhhhhhhhhhh..eeeee.hhh.......eeeee.......eeeeeeee.....hhhhhhhhhhhh...hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fyi D  85 SHMTNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES 307
                                    94       104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (1, 8)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FYI)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D   (CBL_ECOLI | Q47083)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0003700    transcription factor activity, sequence-specific DNA binding    Interacting selectively and non-covalently with a specific DNA sequence in order to modulate transcription. The transcription factor may or may not also interact selectively with a protein or macromolecular complex.
biological process
    GO:0045883    positive regulation of sulfur utilization    Any process that activates or increases the frequency, rate or extent of sulfur utilization.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2fyi)
 
  Sites
(no "Sites" information available for 2fyi)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2fyi)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2fyi
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CBL_ECOLI | Q47083
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CBL_ECOLI | Q47083
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2FYI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FYI)