|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 3)| Asymmetric/Biological Unit (3, 3) |
Sites (3, 3)
Asymmetric Unit (3, 3)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2FXD) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2FXD) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2FXD) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2FXD) |
Exons (0, 0)| (no "Exon" information available for 2FXD) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:99 aligned with Q90HG9_9HIV1 | Q90HG9 from UniProtKB/TrEMBL Length:371 Alignment length:99 10 20 30 40 50 60 70 80 90 Q90HG9_9HIV1 1 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNVIGRNLMTQIGCTLNF 99 SCOP domains d2fxda_ A: Human immunodeficiency virus type 1 protease SCOP domains CATH domains 2fxdA00 A:1-99 Acid Proteases CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2fxd A 1 PQITLWKRPIVTVKIGGQLKEALLDTGADDTVIEEMNLPGKWKPKIIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPFNVIGRNLMTQIGATLNF 99 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:99 aligned with Q90HG9_9HIV1 | Q90HG9 from UniProtKB/TrEMBL Length:371 Alignment length:99 10 20 30 40 50 60 70 80 90 Q90HG9_9HIV1 1 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNVIGRNLMTQIGCTLNF 99 SCOP domains d2fxdb_ B: Human immunodeficiency virus type 1 protease SCOP domains CATH domains 2fxdB00 B:1-99 Acid Proteases CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 2fxd B 1 PQITLWKRPIVTVKIGGQLKEALLDTGADDTVIEEMNLPGKWKPKIIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPFNVIGRNLMTQIGATLNF 99 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric/Biological Unit |
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2FXD) |
Gene Ontology (8, 8)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q90HG9_9HIV1 | Q90HG9)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|