2FVZ - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HUMAN INOSITOL MONOPHOSPHOSPHATASE 2

Authors :   D. Ogg, B. M. Hallberg, C. Arrowsmith, H. Berglund, R. Collins, A. Edwards, M. Ehn, S. Flodin, S. Graslund, M. Hammarstrom, M. Hogbom, L. Holmberg-Schiavone, T. Kotenyova, P. Kursula, P. Nilsson-Ehle, P. Nordlund, T. Nyman, C. Persson, J. Sagemark, P. Stenmark, M. Sundstrom, S. Van Den Berg, J. Weigelt, A. G. Thorsell, Structural Genomics Consortium (Sgc)

Date :   31 Jan 06 (Deposition) - 21 Feb 06 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.40

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,D  (1x)
Biol. Unit 2: B,C  (1x)

Keywords :   Inositol Metabolism, Inositol Monophosphatase, Structural Genomics, Structural Genomics Consortium, Sgc, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. G. Thorsell, D. Ogg, H. Berglund, R. Collins, M. Ehn, S. Flodin, S. Graslund, M. Hammarstrom, M. Hogbom, L. Holmberg-Schiavone, T. Kotenyova, P. Kursula, P. Nilsson-Ehle, C. Persson, P. Nordlund, T. Nyman, J. Sagemark, P. Stenmark, S. Van Den Berg, J. Weigelt, B. M. Hallberg
Structure Of Human Inositol Monophosphatase 2
To Be Published
PubMed: search
(for further references see the PDB file header)

Molecule 1 - INOSITOL MONOPHOSPHATASE 2
	Chains	:	A, B, C, D
	EC Number	:	3.1.3.25
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PNIC-BSA4
	Expression System Strain	:	BL21-DE3
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	IMPA2, IMP.18P
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	IMPASE 2, IMP 2, INOSITOL-1(OR 4)-MONOPHOSPHATASE 2, MYO-INOSITOL MONOPHOSPHATASE A2

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A			D
Biological Unit 2 (1x)	:		B	C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2FVZ)

(no "Site" information available for 2FVZ)

Asymmetric Unit

No.	Residues
1	A:90	-	A:229
2	B:90	-	B:229
3	C:90	-	C:229
4	D:90	-	D:229

Asymmetric Unit

No.	Residues
1	Ala A:88	-	Lys A:89

Asymmetric Unit (1, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049601	A	88	T	IMPA2_HUMAN	Polymorphism	16976948	A/B/C/D	A	88	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049601	A	88	T	IMPA2_HUMAN	Polymorphism	16976948	A/D	A	88	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_049601	A	88	T	IMPA2_HUMAN	Polymorphism	16976948	B/C	A	88	T

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IMP_1	PS00629	Inositol monophosphatase family signature 1.	IMPA2_HUMAN	98-111	4	A:98-111 B:98-111 C:98-111 D:98-111
2	IMP_2	PS00630	Inositol monophosphatase family signature 2.	IMPA2_HUMAN	230-244	4	A:230-244 B:230-244 C:230-244 D:230-244

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IMP_1	PS00629	Inositol monophosphatase family signature 1.	IMPA2_HUMAN	98-111	2	A:98-111 - - D:98-111
2	IMP_2	PS00630	Inositol monophosphatase family signature 2.	IMPA2_HUMAN	230-244	2	A:230-244 - - D:230-244

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	IMP_1	PS00629	Inositol monophosphatase family signature 1.	IMPA2_HUMAN	98-111	2	- B:98-111 C:98-111 -
2	IMP_2	PS00630	Inositol monophosphatase family signature 2.	IMPA2_HUMAN	230-244	2	- B:230-244 C:230-244 -

Asymmetric Unit (8, 32)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000269159	1a	ENSE00001818223	chr18:11981427-11981764	338	IMPA2_HUMAN	1-32	32	4	A:16-32 B:16-32 C:16-32 D:16-32	17 17 17 17
1.2	ENST00000269159	2	ENSE00001268518	chr18:11999053-11999186	134	IMPA2_HUMAN	33-77	45	4	A:33-77 (gaps) B:33-77 (gaps) C:33-77 (gaps) D:33-77 (gaps)	45 45 45 45
1.4	ENST00000269159	4	ENSE00001268511	chr18:12009882-12009986	105	IMPA2_HUMAN	77-112	36	4	A:77-112 (gaps) B:77-112 (gaps) C:77-112 (gaps) D:77-112 (gaps)	36 36 36 36
1.5	ENST00000269159	5	ENSE00000948305	chr18:12012169-12012214	46	IMPA2_HUMAN	112-127	16	4	A:112-127 B:112-127 C:112-127 D:112-127	16 16 16 16
1.6	ENST00000269159	6	ENSE00000948306	chr18:12014264-12014372	109	IMPA2_HUMAN	128-164	37	4	A:128-164 B:128-164 C:128-164 D:128-164	37 37 37 37
1.7	ENST00000269159	7	ENSE00000948307	chr18:12028042-12028150	109	IMPA2_HUMAN	164-200	37	4	A:164-200 B:164-200 C:164-200 D:164-200	37 37 37 37
1.8	ENST00000269159	8	ENSE00000948308	chr18:12028841-12028992	152	IMPA2_HUMAN	200-251	52	4	A:200-251 B:200-251 C:200-251 D:200-251	52 52 52 52
1.9	ENST00000269159	9	ENSE00001268526	chr18:12030342-12030876	535	IMPA2_HUMAN	251-288	38	4	A:251-277 B:251-277 C:251-277 D:251-277	27 27 27 27

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:244
 aligned with IMPA2_HUMAN | O14732 from UniProtKB/Swiss-Prot  Length:288

    Alignment length:262
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275  
          IMPA2_HUMAN    16 WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL 277
               SCOP domains d2fvza_ A: automated match             es                                                                                                                                                                                                                              SCOP domains
               CATH domains 2fvzA01 A:16-157 Fructose-             1,6-Bisphosphatase, subunit      A, domain 1                                                           2fvzA02 A:158-277  [code=3.40.190.80, no name defined]                                                                   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh..-------------hhhhhhhhhhhhhhhhhhh...ee....-----.........eeeeeeeehhhhhhh.....eeeeeeee..eeeeeeeee....eeeeee....eee..ee.......hhhh.eee.......hhhhhhhhhhhhhhhhhh...eee...hhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhh..eee.......hhhh.eeeee.hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------T--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------IMP_1         ----------------------------------------------------------------------------------------------------------------------IMP_2          --------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a        Exon 1.2  PDB: A:33-77 (gaps) UniProt: 33-77 ----------------------------------Exon 1.5        Exon 1.6  PDB: A:128-164             -----------------------------------Exon 1.8  PDB: A:200-251 UniProt: 200-251           -------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------Exon 1.4  PDB: A:77-112 (gaps)      ---------------------------------------------------Exon 1.7  PDB: A:164-200             --------------------------------------------------Exon 1.9  PDB: A:251-277    Transcript 1 (2)
                 2fvz A  16 WEECFQAAVQLALRAGQIIRKALTEE-------------TETDHLVEDLIISELRERFPSHRFIAEE-----AKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL 277
                                    25        35     |   -        55        65        75      |  -  |     95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275  
                                                    41            55                         82    88

Chain B from PDB  Type:PROTEIN  Length:244
 aligned with IMPA2_HUMAN | O14732 from UniProtKB/Swiss-Prot  Length:288

    Alignment length:262
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275  
          IMPA2_HUMAN    16 WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL 277
               SCOP domains d2fvzb_ B: automated match             es                                                                                                                                                                                                                              SCOP domains
               CATH domains 2fvzB01 B:16-157 Fructose-             1,6-Bisphosphatase, subunit      A, domain 1                                                           2fvzB02 B:158-277  [code=3.40.190.80, no name defined]                                                                   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhh...-------------hhhhhhhhhhhhhhhhhhh...eeee..-----.........eeeeeeeehhhhhhhh....eeeeeeee..eeeeeeeee....eeeeee....eee..ee.......hhhh.eee.......hhhhhhhhhhhhhhhhhh...eee...hhhhhhhhhhhh...eeeee...hhhhhhhhhhhhh...eee............eeeee.hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------T--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------IMP_1         ----------------------------------------------------------------------------------------------------------------------IMP_2          --------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a        Exon 1.2  PDB: B:33-77 (gaps) UniProt: 33-77 ----------------------------------Exon 1.5        Exon 1.6  PDB: B:128-164             -----------------------------------Exon 1.8  PDB: B:200-251 UniProt: 200-251           -------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------Exon 1.4  PDB: B:77-112 (gaps)      ---------------------------------------------------Exon 1.7  PDB: B:164-200             --------------------------------------------------Exon 1.9  PDB: B:251-277    Transcript 1 (2)
                 2fvz B  16 WEECFQAAVQLALRAGQIIRKALTEE-------------TETDHLVEDLIISELRERFPSHRFIAEE-----AKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL 277
                                    25        35     |   -        55        65        75      |  -  |     95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275  
                                                    41            55                         82    88

Chain C from PDB  Type:PROTEIN  Length:244
 aligned with IMPA2_HUMAN | O14732 from UniProtKB/Swiss-Prot  Length:288

    Alignment length:262
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275  
          IMPA2_HUMAN    16 WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL 277
               SCOP domains d2fvzc_ C: automated match             es                                                                                                                                                                                                                              SCOP domains
               CATH domains 2fvzC01 C:16-157 Fructose-             1,6-Bisphosphatase, subunit      A, domain 1                                                           2fvzC02 C:158-277  [code=3.40.190.80, no name defined]                                                                   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh..-------------hhhhhhhhhhhhhhhhhhh...eee...-----.........eeeeeeeehhhhhhhh....eeeeeeee..eeeeeeeee....eeeeee...eeee..ee.......hhhh.eee.........hhhhhhhhhhhhhhhh...eee...hhhhhhhhhhh....eeeee..hhhhhhhhhhhhhhh..eee.......hhhh.eeeee.hhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------T--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------IMP_1         ----------------------------------------------------------------------------------------------------------------------IMP_2          --------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a        Exon 1.2  PDB: C:33-77 (gaps) UniProt: 33-77 ----------------------------------Exon 1.5        Exon 1.6  PDB: C:128-164             -----------------------------------Exon 1.8  PDB: C:200-251 UniProt: 200-251           -------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------Exon 1.4  PDB: C:77-112 (gaps)      ---------------------------------------------------Exon 1.7  PDB: C:164-200             --------------------------------------------------Exon 1.9  PDB: C:251-277    Transcript 1 (2)
                 2fvz C  16 WEECFQAAVQLALRAGQIIRKALTEE-------------TETDHLVEDLIISELRERFPSHRFIAEE-----AKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL 277
                                    25        35     |   -        55        65        75      |  -  |     95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275  
                                                    41            55                         82    88

Chain D from PDB  Type:PROTEIN  Length:244
 aligned with IMPA2_HUMAN | O14732 from UniProtKB/Swiss-Prot  Length:288

    Alignment length:262
                                    25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275  
          IMPA2_HUMAN    16 WEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL 277
               SCOP domains d2fvzd_ D: automated match             es                                                                                                                                                                                                                              SCOP domains
               CATH domains 2fvzD01 D:16-157 Fructose-             1,6-Bisphosphatase, subunit      A, domain 1                                                           2fvzD02 D:158-277  [code=3.40.190.80, no name defined]                                                                   CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhh..-------------hhhhhhhhhhhhhhhhhhh...eeee..-----.........eeeeeeeehhhhhhhh....eeeeeeee..eeeeeeeee....eeeeee..eeeee..ee.......hhhh.eee........hhhhhhhhhhhhhhhhh...eee...hhhhhhhhhhhh...eeeee..hhhhhhhhhhhhhhhh.eee.......hhhh.eeeee.hhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------T--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------IMP_1         ----------------------------------------------------------------------------------------------------------------------IMP_2          --------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a        Exon 1.2  PDB: D:33-77 (gaps) UniProt: 33-77 ----------------------------------Exon 1.5        Exon 1.6  PDB: D:128-164             -----------------------------------Exon 1.8  PDB: D:200-251 UniProt: 200-251           -------------------------- Transcript 1 (1)
           Transcript 1 (2) -------------------------------------------------------------Exon 1.4  PDB: D:77-112 (gaps)      ---------------------------------------------------Exon 1.7  PDB: D:164-200             --------------------------------------------------Exon 1.9  PDB: D:251-277    Transcript 1 (2)
                 2fvz D  16 WEECFQAAVQLALRAGQIIRKALTEE-------------TETDHLVEDLIISELRERFPSHRFIAEE-----AKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQAL 277
                                    25        35     |   -        55        65        75      |  -  |     95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275  
                                                    41            55                         82    88

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Multi-domain proteins (alpha and beta) (2421)

Fold: Carbohydrate phosphatase (140)

Superfamily: Carbohydrate phosphatase (140)

Family: automated matches (14)

Protein domain: automated matches (14)

Human (Homo sapiens) [TaxId: 9606] (5)

1a	d2fvza_	A:
1b	d2fvzb_	B:
1c	d2fvzc_	C:
1d	d2fvzd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Fructose-1,6-Bisphosphatase; Chain A, domain 1 (114)

Homologous Superfamily: Fructose-1,6-Bisphosphatase, subunit A, domain 1 (114)

Human (Homo sapiens) (25)

1a	2fvzA01	A:16-157
1b	2fvzB01	B:16-157
1c	2fvzC01	C:16-157
1d	2fvzD01	D:16-157

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: D-Maltodextrin-Binding Protein; domain 2 (600)

Homologous Superfamily: [code=3.40.190.80, no name defined] (109)

Human (Homo sapiens) (25)

2a	2fvzA02	A:158-277
2b	2fvzB02	B:158-277
2c	2fvzC02	C:158-277
2d	2fvzD02	D:158-277

(no "Pfam Domain" information available for 2FVZ)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (IMPA2_HUMAN | O14732)

molecular function
	GO:0016787	hydrolase activity	Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
	GO:0008934	inositol monophosphate 1-phosphatase activity	Catalysis of the reaction: myo-inositol 1-phosphate + H2O = myo-inositol + phosphate.
	GO:0052832	inositol monophosphate 3-phosphatase activity	Catalysis of the reaction: myo-inositol 3-phosphate + H2O = myo-inositol + phosphate.
	GO:0052833	inositol monophosphate 4-phosphatase activity	Catalysis of the reaction: myo-inositol 4-phosphate + H2O = myo-inositol + phosphate.
	GO:0052834	inositol monophosphate phosphatase activity	Catalysis of the reaction: myo-inositol phosphate + H2O = myo-inositol + phosphate.
	GO:0000287	magnesium ion binding	Interacting selectively and non-covalently with magnesium (Mg) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0006021	inositol biosynthetic process	The chemical reactions and pathways resulting in the formation of inositol, 1,2,3,4,5,6-cyclohexanehexol, a growth factor for animals and microorganisms.
	GO:0006020	inositol metabolic process	The chemical reactions and pathways involving inositol, 1,2,3,4,5,6-cyclohexanehexol, a growth factor for animals and microorganisms.
	GO:0046855	inositol phosphate dephosphorylation	The process of removing a phosphate group from any mono- or polyphosphorylated inositol.
	GO:0043647	inositol phosphate metabolic process	The chemical reactions and pathways involving inositol phosphate, 1,2,3,4,5,6-cyclohexanehexol, with one or more phosphate groups attached.
	GO:0006796	phosphate-containing compound metabolic process	The chemical reactions and pathways involving the phosphate group, the anion or salt of any phosphoric acid.
	GO:0046854	phosphatidylinositol phosphorylation	The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2fvz)

	Sites
(no "Sites" information available for 2fvz)

	Cis Peptide Bonds
		Ala A:88 - Lys A:89	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2fvz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	IMPA2_HUMAN \| O14732
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	3.1.3.25
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	IMPA2_HUMAN \| O14732
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	IMPA2_HUMAN \| O14732	:	2czh 2czi 2czk 2ddk

(no "Related Entries Specified in the PDB File" available for 2FVZ)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (4, 4)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 4)

PROSITE Motifs (2, 8)

Exons (8, 32)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (2, 8)

Pfam Domains (0, 0)

Gene Ontology (18, 18)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File