Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF XC6422 FROM XANTHOMONAS CAMPESTRIS: A MEMBER OF A/B SERINE HYDROLASE WITHOUT LID AT 1.6 RESOLUTION
 
Authors :  C. Y. Yang, K. H. Chin, C. C. Chou, A. H. J. Wang, S. H. Chou
Date :  27 Jan 06  (Deposition) - 04 Jul 06  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  A/B Hydrolase, Xanthomonas Campestris, Structural Genomics, X-Ray Diffraction (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. Y. Yang, K. H. Chin, C. C. Chou, A. H. J. Wang, S. H. Chou
Structure Of Xc6422 From Xanthomonas Campestris At 1. 6 A Resolution: A Small Serine Alpha/Beta-Hydrolase
Acta Crystallogr. , Sect. F V. 62 498 2006
PubMed-ID: 16754966  |  Reference-DOI: 10.1107/S1744309106016265
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - XC6422 PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Organism Scientific: XANTHOMONAS CAMPESTRIS
    Organism Taxid: 339
    Synonym: A MEMBER OF A/B SERINE HYDROLASE

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2FUK)

(-) Sites  (0, 0)

(no "Site" information available for 2FUK)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FUK)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2FUK)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FUK)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2FUK)

(-) Exons   (0, 0)

(no "Exon" information available for 2FUK)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:218
 aligned with B0RM26_XANCB | B0RM26 from UniProtKB/TrEMBL  Length:220

    Alignment length:218
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212        
         B0RM26_XANCB     3 NPLFPTESAALTLDGPVGPLDVAVDLPEPDVAVQPVTAIVCHPLSTEGGSMHNKVVTMAARALRELGITVVRFNFRSVGNSAGAFDHGEGEQDDLRAIAAWVRSQRPGDTLWLAGFSFGAYVSLRAAAALEPQVLISIAPPAGRWDFSDVQPPAHWLVIQGDADEIVDPQAVYDWLETLDQQPTLVRMPDTSHFFHRKLIDLRGALQHGVRRWLPATP 220
               SCOP domains d2fuka1 A:3-220 XC6422 protein                                                                                                                                                                                             SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eeeeeee..eeeeeeee..........eeeeee...........hhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhhhhh...eeeeeeehhhhhhhhhhhhhhh..eeeee.................eeeeee......hhhhhhhhhh......eeeee.........hhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fuk A   3 NPLFPTESAALTLDGPVGPLDVAVDLPEPDVAVQPVTAIVCHPLSTEGGSMHNKVVTMAARALRELGITVVRFNFRSVGTSAGSFDHGDGEQDDLRAVAEWVRAQRPTDTLWLAGFSFGAYVSLRAAAALEPQVLISIAPPAGRWDFSDVQPPAQWLVIQGDADEIVDPQAVYDWLETLEQQPTLVRMPDTSHFFHRKLIDLRGALQHGVRRWLPATP 220
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2FUK)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FUK)

(-) Gene Ontology  (1, 1)

Asymmetric Unit(hide GO term definitions)
Chain A   (B0RM26_XANCB | B0RM26)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2fuk)
 
  Sites
(no "Sites" information available for 2fuk)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2fuk)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2fuk
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  B0RM26_XANCB | B0RM26
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  B0RM26_XANCB | B0RM26
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2FUK)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FUK)