|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (5, 5)
|
Asymmetric Unit (5, 5)
|
(no "SS Bond" information available for 2FMH) |
Asymmetric Unit
|
(no "SAP(SNP)/Variant" information available for 2FMH) |
Asymmetric Unit (1, 1)
|
(no "Exon" information available for 2FMH) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:128 aligned with CHEY_SALTY | P0A2D5 from UniProtKB/Swiss-Prot Length:129 Alignment length:128 11 21 31 41 51 61 71 81 91 101 111 121 CHEY_SALTY 2 ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129 SCOP domains d2fmha_ A: CheY protein SCOP domains CATH domains 2fmhA00 A:2-129 [code=3.40.50.2300, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -----RESPONSE_REGULATORY PDB: A:7-124 UniProt: 7-124 ----- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------- Transcript 2fmh A 2 ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGFGFIISDWNMPNMDGLELLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM 129 11 21 31 41 51 61 71 81 91 101 111 121 Chain B from PDB Type:PROTEIN Length:11 aligned with CHEZ_SALTY | P07800 from UniProtKB/Swiss-Prot Length:214 Alignment length:11 213 CHEZ_SALTY 204 QVDDLLDSLGF 214 SCOP domains ----------- SCOP domains CATH domains ----------- CATH domains Pfam domains ----------- Pfam domains SAPs(SNPs) ----------- SAPs(SNPs) PROSITE ----------- PROSITE Transcript ----------- Transcript 2fmh B 204 QVDDLLDSLGF 214 213
|
Asymmetric Unit
|
Asymmetric Unit
|
(no "Pfam Domain" information available for 2FMH) |
Asymmetric Unit(hide GO term definitions) Chain A (CHEY_SALTY | P0A2D5)
Chain B (CHEZ_SALTY | P07800)
|
|
|
|
|
|
|