|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2FI9) |
Sites (0, 0)| (no "Site" information available for 2FI9) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2FI9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2FI9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2FI9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2FI9) |
Exons (0, 0)| (no "Exon" information available for 2FI9) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:118 aligned with Q8RIU4_BARHN | Q8RIU4 from UniProtKB/TrEMBL Length:128 Alignment length:118 20 30 40 50 60 70 80 90 100 110 120 Q8RIU4_BARHN 11 HFPGRAPIDAYGNGGFRFADMSHRGSIICIPSGIYGIDMTGPVPTQEDISRVLEESDQIEVLLIGTGVELLRLPEELRVLLWEKRISSDTMSTGAAVRTFNVLLAEDRAVAALLFAVE 128 SCOP domains d2fi9a1 A:11-128 Hypothetical outer membrane protein BH05650 SCOP domains CATH domains 2fi9A00 A:11-128 [code=3.40.1230.10, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript 2fi9 A 11 HFPGRAPIDAYGNGGFRFADMSHRGSIICIPSGIYGIDMTGPVPTQEDISRVLEESDQIEVLLIGTGVELLRLPEELRVLLWEKRISSDTMSTGAAVRTFNVLLAEDRAVAALLFAVE 128 20 30 40 50 60 70 80 90 100 110 120
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2FI9) |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2FI9)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|