Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PUTATIVE METHYLASE FROM ENTEROCOCCUS FAECALIS
 
Authors :  Y. Kim, M. Zhou, S. Moy, A. Joachimiak, Midwest Center For Structura Genomics (Mcsg)
Date :  26 Dec 05  (Deposition) - 07 Feb 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Alpha-Beta-Alpha Sandwich, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Kim, M. Zhou, S. Moy, A. Joachimiak
Crystal Structure Of Putative Methylase From Enterococcus Faecalis
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - METHYLASE, PUTATIVE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PMCSG7
    Expression System Strain: BL21DE3
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Scientific: ENTEROCOCCUS FAECALIS
    Organism Taxid: 226185
    Strain: V583

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric Unit (1, 12)
No.NameCountTypeFull Name
1MSE12Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2FHP)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FHP)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Gly A:37 -Pro A:38
2Gly B:37 -Pro B:38

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FHP)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2FHP)

(-) Exons   (0, 0)

(no "Exon" information available for 2FHP)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:183
 aligned with Q831P8_ENTFA | Q831P8 from UniProtKB/TrEMBL  Length:184

    Alignment length:183
                             1                                                                                                                                                                                     
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179   
         Q831P8_ENTFA     - -MRVISGEYGGRRLKALDGDNTRPTTDKVKESIFNMIGPYFDGGMALDLYSGSGGLAIEAVSRGMDKSICIEKNFAALKVIKENIAITKEPEKFEVRKMDANRALEQFYEEKLQFDLVLLDPPYAKQEIVSQLEKMLERQLLTNEAVIVCETDKTVKLPETIGTLKKTRETVYGITQVTIYRQ 182
               SCOP domains -d2fhpa1 A:1-182 Putative methylase EF2452                                                                                                                                              SCOP domains
               CATH domains 2fhpA00 A:0-182 Vaccinia Virus protein VP39                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........................hhhhhhhhhhhhh......eeee.....hhhhhhhhhh...eeeeee...hhhhhhhhhhhhhhhhh.eeeee.hhhhhhhhhhhh...eeeeee..hhhhhhhhhhhhhhhhh..eeeeeeeeeeee.......ee..eeeeeeeee..eeeeeee. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fhp A   0 AmRVISGEYGGRRLKALDGDNTRPTTDKVKESIFNmIGPYFDGGmALDLYSGSGGLAIEAVSRGmDKSICIEKNFAALKVIKENIAITKEPEKFEVRKmDANRALEQFYEEKLQFDLVLLDPPYAKQEIVSQLEKmLERQLLTNEAVIVCETDKTVKLPETIGTLKKTRETVYGITQVTIYRQ 182
                             |       9        19        29     |  39    |   49        59    |   69        79        89        99       109       119       129     | 139       149       159       169       179   
                             |                                35-MSE   44-MSE              64-MSE                            98-MSE                              135-MSE                                           
                             1-MSE                                                                                                                                                                                 


Chain B from PDB  Type:PROTEIN  Length:178
 aligned with Q831P8_ENTFA | Q831P8 from UniProtKB/TrEMBL  Length:184

    Alignment length:184
                             1                                                                                                                                                                                      
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179    
         Q831P8_ENTFA     - -MRVISGEYGGRRLKALDGDNTRPTTDKVKESIFNMIGPYFDGGMALDLYSGSGGLAIEAVSRGMDKSICIEKNFAALKVIKENIAITKEPEKFEVRKMDANRALEQFYEEKLQFDLVLLDPPYAKQEIVSQLEKMLERQLLTNEAVIVCETDKTVKLPETIGTLKKTRETVYGITQVTIYRQE 183
               SCOP domains d2fhpb_ B: automate      d matches                                                                                                                                                       SCOP domains
               CATH domains 2fhpB00 B:0-183 Vac      cinia Virus protein VP39                                                                                                                                        CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...................------hhhhhhhhhhhhh......eeee.....hhhhhhhhhh...eeeeee.hhhhhhhhhhhhhhhhhhh.eeeee.hhhhhhhhhhhhh..eeeeee..hhhhhhhhhhhhhhhhh..eeeeeeeeeeee.......ee..eeeeeeeee..eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2fhp B   0 AmRVISGEYGGRRLKALDG------TDKVKESIFNmIGPYFDGGmALDLYSGSGGLAIEAVSRGmDKSICIEKNFAALKVIKENIAITKEPEKFEVRKmDANRALEQFYEEKLQFDLVLLDPPYAKQEIVSQLEKmLERQLLTNEAVIVCETDKTVKLPETIGTLKKTRETVYGITQVTIYRQE 183
                             |       9        |-     |  29     |  39    |   49        59    |   69        79        89        99       109       119       129     | 139       149       159       169       179    
                             1-MSE           18     25        35-MSE   44-MSE              64-MSE                            98-MSE                              135-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FHP)

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q831P8_ENTFA | Q831P8)
molecular function
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0003676    nucleic acid binding    Interacting selectively and non-covalently with any nucleic acid.
biological process
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0031167    rRNA methylation    The posttranscriptional addition of methyl groups to specific residues in an rRNA molecule.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2fhp)
 
  Cis Peptide Bonds
    Gly A:37 - Pro A:38   [ RasMol ]  
    Gly B:37 - Pro B:38   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2fhp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q831P8_ENTFA | Q831P8
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q831P8_ENTFA | Q831P8
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2FHP)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FHP)