Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF PR10-ALLERGEN-LIKE PROTEIN PA1206 FROM PSEUDOMONAS AERUGINOSA PAO1
 
Authors :  M. D. Zimmerman, M. Chruszcz, M. T. Cymborowski, S. Wang, O. Kirillova, T. Skarina, O. Onopriyenko, A. Savchenko, A. Edwards, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  20 Dec 05  (Deposition) - 10 Jan 06  (Release) - 05 Oct 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  7-Stranded Beta Sheet, C-Terminal Helix, Structural Genomics, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. D. Zimmerman, M. Chruszcz, M. T. Cymborowski, S. Wang, O. Kirillova T. Skarina, O. Onopriyenko, A. Savchenko, A. Edwards, W. Minor
Structure Of Pr10-Allergen-Like Protein Pa1206 From Pseudomonas Aeruginosa Pao1
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN PA1206
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET15B (MODIFIED)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: PA1206
    Organism Scientific: PSEUDOMONAS AERUGINOSA
    Organism Taxid: 208964
    Strain: PAO1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric/Biological Unit (1, 6)
No.NameCountTypeFull Name
1MSE6Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2FFS)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2FFS)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ala A:75 -Pro A:76
2Ala B:75 -Pro B:76

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2FFS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2FFS)

(-) Exons   (0, 0)

(no "Exon" information available for 2FFS)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:146
 aligned with Q9I4D2_PSEAE | Q9I4D2 from UniProtKB/TrEMBL  Length:157

    Alignment length:151
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150 
         Q9I4D2_PSEAE     1 MQFEHLVQVNDRTLVDLPVLDRLQLWEGLVCRAREPQYFVVGLERFEILVDDGDRLHRRLYLPGLVVEDEVVLKAPDSAHYSIKPSAEVAGGSLDMTIEEPEPGSLFVRFAYCTRYLQPLGDELPYDAFVKQAYIAMDVETIATIRDRFGA 151
               SCOP domains d2ffsa1 A:1-1   51 Hypothetical protein PA1206                                                                                                          SCOP domains
               CATH domains -2ffsA00 A:2-   151  [code=3.30.530.20, no name defined]                                                                                                CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee.....---....hhhhhhhhhhhhhhhhhhh.....eeeeeee...eeeeeeee..eeeeeeeeee...eeeeee.......eeeeeeeeeeee..eeeeeeeeeee....--.....hhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ffs A   1 mQFEHLVQVNDRT---LPVLDRLQLWEGLVCRAREPQYFVVGLERFEILVDDGDRLHRRLYLPGLVVEDEVVLKAPDSAHYSIKPSAEVAGGSLDmTIEEPEPGSLFVRFAYCTRYLQP--DELPYDAFVKQAYIAmDVETIATIRDRFGA 151
                            |       10  |   | 20        30        40        50        60        70        80        90     | 100       110        |- |     130      |140       150 
                            |          13  17                                                                             96-MSE                119  |            137-MSE          
                            1-MSE                                                                                                                  122                             


Chain B from PDB  Type:PROTEIN  Length:145
 aligned with Q9I4D2_PSEAE | Q9I4D2 from UniProtKB/TrEMBL  Length:157

    Alignment length:149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140         
         Q9I4D2_PSEAE     1 MQFEHLVQVNDRTLVDLPVLDRLQLWEGLVCRAREPQYFVVGLERFEILVDDGDRLHRRLYLPGLVVEDEVVLKAPDSAHYSIKPSAEVAGGSLDMTIEEPEPGSLFVRFAYCTRYLQPLGDELPYDAFVKQAYIAMDVETIATIRDRF 149
               SCOP domains d2ffsb_ B: Hy  pothetical protein PA1206                                                                                                              SCOP domains
               CATH domains -2ffsB00 B:2-  149  [code=3.30.530.20, no name defined]                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.....--.....hhhhhhhhhhhhhhhhhhh.....eeeeeee...eeeeeeee..eeeeeeeeee...eeeeee.......eeeeeeeeeeee..eeeeeeeeeee....--.....hhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ffs B   1 mQFEHLVQVNDRT--DLPVLDRLQLWEGLVCRAREPQYFVVGLERFEILVDDGDRLHRRLYLPGLVVEDEVVLKAPDSAHYSIKPSAEVAGGSLDmTIEEPEPGSLFVRFAYCTRYLQP--DELPYDAFVKQAYIAmDVETIATIRDRF 149
                            |       10  |  |  20        30        40        50        60        70        80        90     | 100       110        |- |     130      |140         
                            1-MSE      13 16                                                                              96-MSE                119  |            137-MSE        
                                                                                                                                                   122
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2FFS)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2FFS)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2ffs)
 
  Cis Peptide Bonds
    Ala A:75 - Pro A:76   [ RasMol ]  
    Ala B:75 - Pro B:76   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ffs
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9I4D2_PSEAE | Q9I4D2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9I4D2_PSEAE | Q9I4D2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2FFS)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2FFS)