Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF E.COLI GUANYLATE KINASE IN COMPLEX WITH AP5G
 
Authors :  G. Hible, J. Cherfils
Date :  22 Nov 05  (Deposition) - 30 May 06  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (3x)
Keywords :  Transferase, Gmp Kinase, Guanylate Kinase, Nucleotide Analogue (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Hible, P. Daalova, A. M. Gilles, J. Cherfils
Crystal Structures Of Gmp Kinase In Complex With Ganciclovi Monophosphate And Ap5G.
Biochimie V. 88 1157 2006
PubMed-ID: 16690197  |  Reference-DOI: 10.1016/J.BIOCHI.2006.04.002

(-) Compounds

Molecule 1 - GUANYLATE KINASE
    ChainsA, B
    EC Number2.7.4.8
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET24A
    Expression System StrainBLI5
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneGMK, SPOR
    Organism ScientificESCHERICHIA COLI
    Organism Taxid562
    SynonymGMP KINASE

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (3x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1G5P2Ligand/IonP1-(5'-ADENOSYL)-P5-(5'-GUANOSYL) PENTAPHOSPHATE
Biological Unit 1 (1, 6)
No.NameCountTypeFull Name
1G5P6Ligand/IonP1-(5'-ADENOSYL)-P5-(5'-GUANOSYL) PENTAPHOSPHATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:13 , GLY A:14 , ALA A:15 , GLY A:16 , LYS A:17 , SER A:18 , SER A:19 , LEU A:30 , TYR A:31 , GLN A:34 , SER A:38 , ARG A:42 , ARG A:45 , TYR A:54 , GLU A:73 , ALA A:75 , TYR A:82 , GLY A:83 , THR A:84 , THR A:95 , VAL A:97 , ASP A:102 , ILE A:103 , ASP A:104 , ARG A:133 , ARG A:134 , LEU A:135 , GLY A:137 , HOH A:606BINDING SITE FOR RESIDUE G5P A 601
2AC2SOFTWARESER B:13 , GLY B:14 , ALA B:15 , GLY B:16 , LYS B:17 , SER B:18 , SER B:19 , TYR B:31 , GLN B:34 , SER B:38 , ARG B:42 , ARG B:45 , TYR B:54 , GLU B:73 , TYR B:82 , GLY B:83 , THR B:84 , THR B:95 , VAL B:97 , ASP B:102 , ILE B:103 , ASP B:104 , GLY B:107 , ARG B:134 , GLY B:137 , HOH B:604 , HOH B:609 , HOH B:610BINDING SITE FOR RESIDUE G5P B 602

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2F3R)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2F3R)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2F3R)

(-) PROSITE Motifs  (2, 4)

Asymmetric Unit (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GUANYLATE_KINASE_2PS50052 Guanylate kinase-like domain profile.KGUA_ECOLI4-184
 
  2A:4-184
B:4-184
2GUANYLATE_KINASE_1PS00856 Guanylate kinase-like signature.KGUA_ECOLI40-57
 
  2A:40-57
B:40-57
Biological Unit 1 (2, 12)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1GUANYLATE_KINASE_2PS50052 Guanylate kinase-like domain profile.KGUA_ECOLI4-184
 
  6A:4-184
B:4-184
2GUANYLATE_KINASE_1PS00856 Guanylate kinase-like signature.KGUA_ECOLI40-57
 
  6A:40-57
B:40-57

(-) Exons   (0, 0)

(no "Exon" information available for 2F3R)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:201
 aligned with KGUA_ECOLI | P60546 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:205
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201     
           KGUA_ECOLI     2 AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA 206
               SCOP domains d2f3ra_ A: Guanylate kinase                                                                                                                                                                                   SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee.....hhhhhhhhhhh......eee..eee.............eee.hhhhhhhhhhh..eeeeeee..eeeeeehhhhhhhhhh..eeeee.hhhhhhhhhhhh...eeeeee..hhhhhhhhhhh----hhhhhhhhhhhhhhhhhhhhhh.eeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --GUANYLATE_KINASE_2  PDB: A:4-184 UniProt: 4-184                                                                                                                                      ---------------------- PROSITE (1)
                PROSITE (2) --------------------------------------GUANYLATE_KINASE_1----------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2f3r A   2 AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRG----SEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA 206
                                    11        21        31        41        51        61        71        81        91       101       111       121       131     |   -|      151       161       171       181       191       201     
                                                                                                                                                                 137  142                                                                

Chain B from PDB  Type:PROTEIN  Length:199
 aligned with KGUA_ECOLI | P60546 from UniProtKB/Swiss-Prot  Length:207

    Alignment length:203
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201   
           KGUA_ECOLI     2 AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKL 204
               SCOP domains d2f3rb_ B: Guanylate kinase                                                                                                                                                                                 SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeee.....hhhhhhhhhhh......eee...ee..............ee.hhhhhhhhhhh..eeeeee....eeeeehhhhhhhhh...eeeee.hhhhhhhhhhhh...eeeeee..hhhhhhhhhh.----hhhhhhhhhhhhhhhhhhhhhh.eeee..hhhhhhhhhhhhhhhhh.hhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --GUANYLATE_KINASE_2  PDB: B:4-184 UniProt: 4-184                                                                                                                                      -------------------- PROSITE (1)
                PROSITE (2) --------------------------------------GUANYLATE_KINASE_1--------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2f3r B   2 AQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRG----SEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKL 204
                                    11        21        31        41        51        61        71        81        91       101       111       121       131     |   -|      151       161       171       181       191       201   
                                                                                                                                                                 137  142                                                              

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2F3R)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2F3R)

(-) Gene Ontology  (12, 12)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (KGUA_ECOLI | P60546)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0004385    guanylate kinase activity    Catalysis of the reaction: ATP + GMP = ADP + GDP.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016301    kinase activity    Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0046710    GDP metabolic process    The chemical reactions and pathways involving GDP, guanosine 5'-diphosphate.
    GO:0046037    GMP metabolic process    The chemical reactions and pathways involving GMP, guanosine monophosphate.
    GO:0016310    phosphorylation    The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
    GO:0006163    purine nucleotide metabolic process    The chemical reactions and pathways involving a purine nucleotide, a compound consisting of nucleoside (a purine base linked to a deoxyribose or ribose sugar) esterified with a phosphate group at either the 3' or 5'-hydroxyl group of the sugar.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    G5P  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2f3r)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2f3r
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KGUA_ECOLI | P60546
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.7.4.8
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  KGUA_ECOLI | P60546
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KGUA_ECOLI | P605461s96 2an9 2anb 2anc 2f3t

(-) Related Entries Specified in the PDB File

2f3t THE SAME PROTEIN COMPLEXED WITH GANCICLOVIR MONOPHOSPHATE