Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PROTEIN BT0572 FROM BACTEROIDES THETAIOTAOMICRON
 
Authors :  C. Chang, L. Volkart, F. Collart, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  11 Nov 05  (Deposition) - 27 Dec 05  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Structural Genomics Hypothetical Protein, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Chang, L. Volkart, F. Collart, A. Joachimiak
Crystal Structure Of Protein Bt0572 From Bacteroides Thetaiotaomicron
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CONSERVED HYPOTHETICAL PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPMCSG
    Expression System StrainBL21(DE3) DERIVATIVE
    Expression System Taxid562
    Organism ScientificBACTEROIDES THETAIOTAOMICRON
    Organism Taxid226186
    StrainVPI-5482

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric Unit (2, 8)
No.NameCountTypeFull Name
1HIS2Mod. Amino AcidHISTIDINE
2MSE6Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (2, 16)
No.NameCountTypeFull Name
1HIS4Mod. Amino AcidHISTIDINE
2MSE12Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN B:30 , LEU B:31 , ASN B:78 , VAL B:79 , ALA B:82 , LEU B:83 , SER B:102 , ALA B:104 , ALA B:109 , HOH B:156 , HOH B:169 , HOH B:170BINDING SITE FOR RESIDUE HIS B 151
2AC2SOFTWAREASN A:30 , LEU A:31 , PRO A:77 , ASN A:78 , VAL A:79 , ALA A:82 , LEU A:83 , SER A:102 , ALA A:109 , HOH A:156 , HOH A:157 , HOH A:158BINDING SITE FOR RESIDUE HIS A 152

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:35 -A:35
2B:35 -B:35

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2F06)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2F06)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2F06)

(-) Exons   (0, 0)

(no "Exon" information available for 2F06)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:145
 aligned with Q8AA93_BACTN | Q8AA93 from UniProtKB/TrEMBL  Length:141

    Alignment length:145
                               1                                                                                                                                         141 
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137   | 
         Q8AA93_BACTN     - ---MVAKQLSIFLENKSGRLTEVTEVLAKENINLSALCIAENADFGILRGIVSDPDKAYKALKDNHFAVNITDVVGISCPNVPGALAKVLGFLSAEGVFIEYMYSFANNNVANVVIRPSNMDKCIEVLKEKKVDLLAASDLYKL-   -
               SCOP domains ---d2f06a2 A:1-70 Hypothetical protein BT0572                            d2f06a1 A:71-141 Hypothetical protein BT0572                           - SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeee....hhhhhhhhhhhhh...eeeeeeee....eeeeeee.hhhhhhhhhhhh...eeeeeeeeeeee...hhhhhhhhhhhhh...eeeeeeeee..eeeeeeee.hhhhhhhhhhhh..eeehhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2f06 A  -2 SNAmVAKQLSIFLENKSGRLTEVTEVLAKENINLSALCIAENADFGILRGIVSDPDKAYKALKDNHFAVNITDVVGISCPNVPGALAKVLGFLSAEGVFIEYmYSFANNNVANVVIRPSNmDKCIEVLKEKKVDLLAASDLYKLH 152
                               |     7        17        27        37        47        57        67        77        87        97  |    107       117|      127       137   ||
                               |                                                                                                100-MSE           118-MSE                141|
                               1-MSE                                                                                                                                      152

Chain B from PDB  Type:PROTEIN  Length:145
 aligned with Q8AA93_BACTN | Q8AA93 from UniProtKB/TrEMBL  Length:141

    Alignment length:145
                               1                                                                                                                                         141 
                               |     7        17        27        37        47        57        67        77        87        97       107       117       127       137   | 
         Q8AA93_BACTN     - ---MVAKQLSIFLENKSGRLTEVTEVLAKENINLSALCIAENADFGILRGIVSDPDKAYKALKDNHFAVNITDVVGISCPNVPGALAKVLGFLSAEGVFIEYMYSFANNNVANVVIRPSNMDKCIEVLKEKKVDLLAASDLYKL-   -
               SCOP domains d2f06b2 B:-2-70 Hypothetical protein BT0572                              d2f06b1 B:71-141 Hypothetical protein BT0572                           - SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeeeeeee....hhhhhhhhhhhhh...eeeeeeee....eeeeeee.hhhhhhhhhhhh...eeeeeeeeeeee...hhhhhhhhhhhhh...eeeeeeeee..eeeeeeee.hhhhhhhhhhhh..ee.hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2f06 B  -2 SNAmVAKQLSIFLENKSGRLTEVTEVLAKENINLSALCIAENADFGILRGIVSDPDKAYKALKDNHFAVNITDVVGISCPNVPGALAKVLGFLSAEGVFIEYmYSFANNNVANVVIRPSNmDKCIEVLKEKKVDLLAASDLYKLH 151
                               |     7        17        27        37        47        57        67        77        87        97  |    107       117|      127       137   ||
                               |                                                                                                100-MSE           118-MSE                141|
                               1-MSE                                                                                                                                      151

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric Unit

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2F06)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2F06)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q8AA93_BACTN | Q8AA93)
molecular function
    GO:0016597    amino acid binding    Interacting selectively and non-covalently with an amino acid, organic acids containing one or more amino substituents.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HIS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2f06)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2f06
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8AA93_BACTN | Q8AA93
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8AA93_BACTN | Q8AA93
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2F06)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2F06)